Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8876
Gene name	Vanin 1
Gene symbol	VNN1
Synonyms (NCBI Gene)	HDLCQ8Tiff66
Chromosome	6
Chromosome location	6q23.2
Summary	This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participa

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT446019	hsa-miR-5004-5p	PAR-CLIP	22100165
MIRT446018	hsa-miR-4751	PAR-CLIP	22100165
MIRT446016	hsa-miR-924	PAR-CLIP	22100165
MIRT446017	hsa-miR-1289	PAR-CLIP	22100165
MIRT446015	hsa-miR-4294	PAR-CLIP	22100165
MIRT446014	hsa-miR-4796-5p	PAR-CLIP	22100165
MIRT446013	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446012	hsa-miR-3915	PAR-CLIP	22100165
MIRT446011	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT446010	hsa-miR-4689	PAR-CLIP	22100165
MIRT446008	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT446009	hsa-miR-3198	PAR-CLIP	22100165
MIRT446007	hsa-miR-4309	PAR-CLIP	22100165
MIRT446019	hsa-miR-5004-5p	PAR-CLIP	22100165
MIRT446018	hsa-miR-4751	PAR-CLIP	22100165
MIRT446016	hsa-miR-924	PAR-CLIP	22100165
MIRT446017	hsa-miR-1289	PAR-CLIP	22100165
MIRT446015	hsa-miR-4294	PAR-CLIP	22100165
MIRT446014	hsa-miR-4796-5p	PAR-CLIP	22100165
MIRT446013	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446012	hsa-miR-3915	PAR-CLIP	22100165
MIRT446011	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT446010	hsa-miR-4689	PAR-CLIP	22100165
MIRT446008	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT446009	hsa-miR-3198	PAR-CLIP	22100165
MIRT446007	hsa-miR-4309	PAR-CLIP	22100165
MIRT446019	hsa-miR-5004-5p	PAR-CLIP	22100165
MIRT446018	hsa-miR-4751	PAR-CLIP	22100165
MIRT446016	hsa-miR-924	PAR-CLIP	22100165
MIRT446017	hsa-miR-1289	PAR-CLIP	22100165
MIRT446015	hsa-miR-4294	PAR-CLIP	22100165
MIRT446014	hsa-miR-4796-5p	PAR-CLIP	22100165
MIRT446013	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446012	hsa-miR-3915	PAR-CLIP	22100165
MIRT446011	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT446010	hsa-miR-4689	PAR-CLIP	22100165
MIRT446008	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT446009	hsa-miR-3198	PAR-CLIP	22100165
MIRT446007	hsa-miR-4309	PAR-CLIP	22100165
MIRT446019	hsa-miR-5004-5p	PAR-CLIP	22100165
MIRT446018	hsa-miR-4751	PAR-CLIP	22100165
MIRT446016	hsa-miR-924	PAR-CLIP	22100165
MIRT446017	hsa-miR-1289	PAR-CLIP	22100165
MIRT446015	hsa-miR-4294	PAR-CLIP	22100165
MIRT446014	hsa-miR-4796-5p	PAR-CLIP	22100165
MIRT446013	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446012	hsa-miR-3915	PAR-CLIP	22100165
MIRT446011	hsa-miR-1224-5p	PAR-CLIP	22100165
MIRT446010	hsa-miR-4689	PAR-CLIP	22100165
MIRT446008	hsa-miR-6858-5p	PAR-CLIP	22100165
MIRT446009	hsa-miR-3198	PAR-CLIP	22100165
MIRT446007	hsa-miR-4309	PAR-CLIP	22100165
MIRT1485676	hsa-miR-10a	CLIP-seq
MIRT1485677	hsa-miR-10b	CLIP-seq
MIRT1485678	hsa-miR-1207-5p	CLIP-seq
MIRT1485679	hsa-miR-1255a	CLIP-seq
MIRT1485680	hsa-miR-1255b	CLIP-seq
MIRT1485681	hsa-miR-1290	CLIP-seq
MIRT1485682	hsa-miR-1305	CLIP-seq
MIRT1485683	hsa-miR-296-3p	CLIP-seq
MIRT1485684	hsa-miR-3133	CLIP-seq
MIRT1485685	hsa-miR-3182	CLIP-seq
MIRT1485686	hsa-miR-339-5p	CLIP-seq
MIRT1485687	hsa-miR-3667-5p	CLIP-seq
MIRT1485688	hsa-miR-3671	CLIP-seq
MIRT1485689	hsa-miR-4307	CLIP-seq
MIRT1485690	hsa-miR-4318	CLIP-seq
MIRT1485691	hsa-miR-432	CLIP-seq
MIRT1485692	hsa-miR-4421	CLIP-seq
MIRT1485693	hsa-miR-4474-3p	CLIP-seq
MIRT1485694	hsa-miR-4652-3p	CLIP-seq
MIRT1485695	hsa-miR-4659a-3p	CLIP-seq
MIRT1485696	hsa-miR-4659b-3p	CLIP-seq
MIRT1485697	hsa-miR-4725-5p	CLIP-seq
MIRT1485698	hsa-miR-4736	CLIP-seq
MIRT1485699	hsa-miR-4761-5p	CLIP-seq
MIRT1485700	hsa-miR-4763-3p	CLIP-seq
MIRT1485701	hsa-miR-504	CLIP-seq
MIRT1485702	hsa-miR-515-5p	CLIP-seq
MIRT1485703	hsa-miR-548u	CLIP-seq
MIRT1485704	hsa-miR-578	CLIP-seq
MIRT1485705	hsa-miR-607	CLIP-seq
MIRT1485706	hsa-miR-888	CLIP-seq
MIRT2146015	hsa-miR-3652	CLIP-seq
MIRT2146016	hsa-miR-4430	CLIP-seq
MIRT1485699	hsa-miR-4761-5p	CLIP-seq
MIRT2146017	hsa-miR-485-5p	CLIP-seq
MIRT2366485	hsa-miR-219-1-3p	CLIP-seq
MIRT2366486	hsa-miR-23a	CLIP-seq
MIRT2366487	hsa-miR-23b	CLIP-seq
MIRT2366488	hsa-miR-23c	CLIP-seq
MIRT2366489	hsa-miR-335	CLIP-seq
MIRT2366490	hsa-miR-3977	CLIP-seq
MIRT2366491	hsa-miR-4303	CLIP-seq
MIRT2366492	hsa-miR-4473	CLIP-seq
MIRT2366493	hsa-miR-4495	CLIP-seq
MIRT2366494	hsa-miR-4649-3p	CLIP-seq
MIRT2366495	hsa-miR-4682	CLIP-seq
MIRT2366496	hsa-miR-4704-3p	CLIP-seq
MIRT2366497	hsa-miR-512-3p	CLIP-seq
MIRT2366498	hsa-miR-520f	CLIP-seq
MIRT2366499	hsa-miR-571	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002526	Process	Acute inflammatory response	IEA
GO:0002526	Process	Acute inflammatory response	ISS	14966568
GO:0002544	Process	Chronic inflammatory response	IEA
GO:0002544	Process	Chronic inflammatory response	ISS	14966568
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS	15282320
GO:0006979	Process	Response to oxidative stress	TAS	17145956
GO:0015938	Process	Coenzyme A catabolic process	IEA
GO:0015939	Process	Pantothenate metabolic process	IBA
GO:0015939	Process	Pantothenate metabolic process	IDA	11491533, 25478849
GO:0015939	Process	Pantothenate metabolic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	17145956
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0017159	Function	Pantetheine hydrolase activity	IBA
GO:0017159	Function	Pantetheine hydrolase activity	IDA	11491533, 25478849
GO:0017159	Function	Pantetheine hydrolase activity	IEA
GO:0017159	Function	Pantetheine hydrolase activity	TAS
GO:0033089	Process	Positive regulation of T cell differentiation in thymus	IEA
GO:0033089	Process	Positive regulation of T cell differentiation in thymus	ISS	11491533
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS	14966568
GO:0098552	Component	Side of membrane	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098609	Process	Cell-cell adhesion	ISS	11491533
GO:1902177	Process	Positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902177	Process	Positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	ISS	15282320

MIM	HGNC	e!Ensembl
603570	12705	ENSG00000112299

O95497

Protein name

Pantetheinase (EC 3.5.1.92) (Pantetheine hydrolase) (Tiff66) (Vascular non-inflammatory molecule 1) (Vanin-1)

Protein function

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. {ECO:0000269|PubMed:10567687, ECO:0000269|PubMed:11491533, ECO:0000269|PubMed:2547

PDB

4CYF , 4CYG , 4CYY , 7SLV , 7SLX , 7SLY , 9IZL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00795	CN_hydrolase	50 → 299	Carbon-nitrogen hydrolase	Family
PF19018	Vanin_C	331 → 483	Vanin C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin. {ECO:0000269|PubMed:19322213}.

Sequence

MTTQLPAYVAILLFYVSRASCQDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDIL
EGAITSAADQGAHIIVTPEDAIYGWNFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPV
QERLSCLAKNNSIYVVANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQN
LFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAVTLVKDFHVDTIVFPTAWMN
VLPHLSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIYAPNSSRAFHYDMKTEEGKLL
LSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKD
LCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETAST
RFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLY
EKDWASNASSGLTAQARIIMLIVIAPIVCSLSW

Sequence length

513

Interactions

View interactions

	KEGG		Reactome
	Pantothenate and CoA biosynthesis Metabolic pathways		Post-translational modification: synthesis of GPI-anchored proteins Vitamin B5 (pantothenate) metabolism Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECLASSIFIED - VNN1 POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	27281478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25910714, 29521598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27281478		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27281478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38022651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36395397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24045843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	BEFREE	31311999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19322213, 23949622, 28316092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	19322213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28316092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19795455, 24687856, 28316092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20846378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	CTD_human_DG	19322213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	CTD_human_DG	17873875		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	32424199	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema, Infantile	Eczema	CTD_human_DG	19322213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Syndrome	Fanconi Syndrome	BEFREE	21437649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30551545, 30699409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	30332759, 30791405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27281478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18043751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18043751, 21550219, 31514290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18043751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	21325602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	17145956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23949622		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	30791405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21550219, 28316092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28316092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29976064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephropathic cystinosis	Nephropathic Cystinosis	BEFREE	21437649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36527111	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19322213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19322213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	19322213	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	40640242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19322213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24106341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23949622		★★★★★ ★☆☆☆☆ Found in Text Mining only

VNN1 (vanin 1)