Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8875
Gene name	Vanin 2
Gene symbol	VNN2
Synonyms (NCBI Gene)	FOAP-4GPI-80
Chromosome	6
Chromosome location	6q23.2
Summary	This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to particip

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016760	hsa-miR-335-5p	Microarray	18185580
MIRT022124	hsa-miR-124-3p	Microarray	18668037
MIRT028816	hsa-miR-26b-5p	Microarray	19088304
MIRT1485707	hsa-miR-1236	CLIP-seq
MIRT1485708	hsa-miR-2467-5p	CLIP-seq
MIRT1485709	hsa-miR-3135b	CLIP-seq
MIRT1485710	hsa-miR-3188	CLIP-seq
MIRT1485711	hsa-miR-3652	CLIP-seq
MIRT1485712	hsa-miR-3975	CLIP-seq
MIRT1485713	hsa-miR-4430	CLIP-seq
MIRT1485714	hsa-miR-4487	CLIP-seq
MIRT1485715	hsa-miR-4633-3p	CLIP-seq
MIRT1485716	hsa-miR-4653-3p	CLIP-seq
MIRT1485717	hsa-miR-4729	CLIP-seq
MIRT1485718	hsa-miR-4753-3p	CLIP-seq
MIRT1485719	hsa-miR-485-5p	CLIP-seq
MIRT1485720	hsa-miR-579	CLIP-seq
MIRT2366500	hsa-miR-1272	CLIP-seq
MIRT2366501	hsa-miR-1322	CLIP-seq
MIRT2366502	hsa-miR-298	CLIP-seq
MIRT2366503	hsa-miR-3157-5p	CLIP-seq
MIRT2366504	hsa-miR-4691-3p	CLIP-seq
MIRT1485707	hsa-miR-1236	CLIP-seq
MIRT1485718	hsa-miR-4753-3p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0015939	Process	Pantothenate metabolic process	IBA
GO:0015939	Process	Pantothenate metabolic process	IDA	11491533
GO:0015939	Process	Pantothenate metabolic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0017159	Function	Pantetheine hydrolase activity	IBA
GO:0017159	Function	Pantetheine hydrolase activity	IDA	11491533
GO:0017159	Function	Pantetheine hydrolase activity	IEA
GO:0017159	Function	Pantetheine hydrolase activity	TAS
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
603571	12706	ENSG00000112303

O95498

Protein name

Pantetheine hydrolase VNN2 (EC 3.5.1.92) (Glycosylphosphatidyl inositol-anchored protein GPI-80) (Protein FOAP-4) (Vascular non-inflammatory molecule 2) (Vanin-2)

Protein function

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine (PubMed:11491533). Involved in the thymus homing of bone marrow cells. May regulate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00795	CN_hydrolase	51 → 262	Carbon-nitrogen hydrolase	Family
PF19018	Vanin_C	337 → 487	Vanin C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with higher expression in spleen and blood. {ECO:0000269|PubMed:19322213}.

Sequence

MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDI
LETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTP
VQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKY
HLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMN
VLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLL
LSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTV
CQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVE
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLF
GRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Pantothenate and CoA biosynthesis Metabolic pathways		Post-translational modification: synthesis of GPI-anchored proteins Vitamin B5 (pantothenate) metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DERMATITIS, ATOPIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12237255, 17453718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32823285	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	34465876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	CTD_human_DG	19322213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	37773841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	19322213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12901795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Syndrome	Fanconi Syndrome	BEFREE	21437649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28551851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28551851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34953280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17453718	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27569996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	31776298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31776298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29976064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephropathic cystinosis	Nephropathic Cystinosis	BEFREE	21437649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30066949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36527111	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34769456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19322213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19322213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19322213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35309355	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	12967480		★★★★★ ★☆☆☆☆ Found in Text Mining only

VNN2 (vanin 2)