Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8874
Gene name	Rho guanine nucleotide exchange factor 7
Gene symbol	ARHGEF7
Synonyms (NCBI Gene)	BETA-PIXCOOL-1COOL1Nbla10314P50P50BPP85P85COOL1P85SPRPAK3PIXB
Chromosome	13
Chromosome location	13q34
Summary	This gene encodes a protein that belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffle

355

Show/Hide all (355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030425	hsa-miR-24-3p	Microarray	19748357
MIRT050964	hsa-miR-17-5p	CLASH	23622248
MIRT050571	hsa-miR-20a-5p	CLASH	23622248
MIRT040805	hsa-miR-18a-3p	CLASH	23622248
MIRT374484	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT374489	hsa-miR-5680	PAR-CLIP	20371350
MIRT374488	hsa-miR-3919	PAR-CLIP	20371350
MIRT570925	hsa-miR-3185	PAR-CLIP	20371350
MIRT570924	hsa-miR-509-3p	PAR-CLIP	20371350
MIRT570923	hsa-miR-1256	PAR-CLIP	20371350
MIRT570922	hsa-miR-4642	PAR-CLIP	20371350
MIRT441195	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050571	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT441194	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT441195	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050964	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT728316	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT728315	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT728314	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT050571	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT441194	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT374484	hsa-miR-580-5p	PAR-CLIP	20371350
MIRT374489	hsa-miR-5680	PAR-CLIP	20371350
MIRT374488	hsa-miR-3919	PAR-CLIP	20371350
MIRT570925	hsa-miR-3185	PAR-CLIP	20371350
MIRT570924	hsa-miR-509-3p	PAR-CLIP	20371350
MIRT570923	hsa-miR-1256	PAR-CLIP	20371350
MIRT570922	hsa-miR-4642	PAR-CLIP	20371350
MIRT796042	hsa-miR-1246	CLIP-seq
MIRT796043	hsa-miR-146b-3p	CLIP-seq
MIRT796044	hsa-miR-188-3p	CLIP-seq
MIRT796045	hsa-miR-21	CLIP-seq
MIRT796046	hsa-miR-22	CLIP-seq
MIRT796047	hsa-miR-2964a-5p	CLIP-seq
MIRT796048	hsa-miR-3136-5p	CLIP-seq
MIRT796049	hsa-miR-3173-5p	CLIP-seq
MIRT796050	hsa-miR-3180-5p	CLIP-seq
MIRT796051	hsa-miR-361-5p	CLIP-seq
MIRT796052	hsa-miR-3673	CLIP-seq
MIRT796053	hsa-miR-4310	CLIP-seq
MIRT796054	hsa-miR-4439	CLIP-seq
MIRT796055	hsa-miR-4471	CLIP-seq
MIRT796056	hsa-miR-4513	CLIP-seq
MIRT796057	hsa-miR-4690-5p	CLIP-seq
MIRT796058	hsa-miR-4764-5p	CLIP-seq
MIRT796059	hsa-miR-4786-3p	CLIP-seq
MIRT796060	hsa-miR-4795-3p	CLIP-seq
MIRT796061	hsa-miR-4803	CLIP-seq
MIRT796062	hsa-miR-520a-5p	CLIP-seq
MIRT796063	hsa-miR-525-5p	CLIP-seq
MIRT796064	hsa-miR-590-5p	CLIP-seq
MIRT796065	hsa-miR-604	CLIP-seq
MIRT796066	hsa-miR-625	CLIP-seq
MIRT796067	hsa-miR-874	CLIP-seq
MIRT796068	hsa-miR-889	CLIP-seq
MIRT796069	hsa-miR-1200	CLIP-seq
MIRT796070	hsa-miR-1204	CLIP-seq
MIRT796071	hsa-miR-1224-5p	CLIP-seq
MIRT796072	hsa-miR-1252	CLIP-seq
MIRT796073	hsa-miR-1281	CLIP-seq
MIRT796074	hsa-miR-1304	CLIP-seq
MIRT796075	hsa-miR-1324	CLIP-seq
MIRT796076	hsa-miR-150	CLIP-seq
MIRT796077	hsa-miR-185	CLIP-seq
MIRT796078	hsa-miR-2467-3p	CLIP-seq
MIRT796079	hsa-miR-300	CLIP-seq
MIRT796080	hsa-miR-3126-5p	CLIP-seq
MIRT796081	hsa-miR-3128	CLIP-seq
MIRT796082	hsa-miR-3156-5p	CLIP-seq
MIRT796083	hsa-miR-3171	CLIP-seq
MIRT796084	hsa-miR-3180	CLIP-seq
MIRT796085	hsa-miR-3180-3p	CLIP-seq
MIRT796086	hsa-miR-3184	CLIP-seq
MIRT796087	hsa-miR-3196	CLIP-seq
MIRT796088	hsa-miR-320e	CLIP-seq
MIRT796089	hsa-miR-325	CLIP-seq
MIRT796090	hsa-miR-3606	CLIP-seq
MIRT796091	hsa-miR-3657	CLIP-seq
MIRT796092	hsa-miR-369-3p	CLIP-seq
MIRT796093	hsa-miR-374a	CLIP-seq
MIRT796094	hsa-miR-374b	CLIP-seq
MIRT796095	hsa-miR-381	CLIP-seq
MIRT796096	hsa-miR-382	CLIP-seq
MIRT796097	hsa-miR-383	CLIP-seq
MIRT796098	hsa-miR-3909	CLIP-seq
MIRT796099	hsa-miR-3915	CLIP-seq
MIRT796100	hsa-miR-3928	CLIP-seq
MIRT796101	hsa-miR-410	CLIP-seq
MIRT796102	hsa-miR-423-5p	CLIP-seq
MIRT796103	hsa-miR-4279	CLIP-seq
MIRT796104	hsa-miR-4306	CLIP-seq
MIRT796105	hsa-miR-4324	CLIP-seq
MIRT796106	hsa-miR-4326	CLIP-seq
MIRT796107	hsa-miR-4419a	CLIP-seq
MIRT796108	hsa-miR-4420	CLIP-seq
MIRT796109	hsa-miR-4424	CLIP-seq
MIRT796110	hsa-miR-4436b-3p	CLIP-seq
MIRT796111	hsa-miR-4510	CLIP-seq
MIRT796112	hsa-miR-4533	CLIP-seq
MIRT796113	hsa-miR-4639-5p	CLIP-seq
MIRT796114	hsa-miR-4644	CLIP-seq
MIRT796115	hsa-miR-4666-3p	CLIP-seq
MIRT796116	hsa-miR-4669	CLIP-seq
MIRT796117	hsa-miR-4682	CLIP-seq
MIRT796118	hsa-miR-4686	CLIP-seq
MIRT796119	hsa-miR-4689	CLIP-seq
MIRT796120	hsa-miR-4699-3p	CLIP-seq
MIRT796121	hsa-miR-4704-3p	CLIP-seq
MIRT796122	hsa-miR-4724-5p	CLIP-seq
MIRT796123	hsa-miR-4736	CLIP-seq
MIRT796124	hsa-miR-4753-3p	CLIP-seq
MIRT796125	hsa-miR-4761-5p	CLIP-seq
MIRT796126	hsa-miR-5095	CLIP-seq
MIRT796127	hsa-miR-544b	CLIP-seq
MIRT796128	hsa-miR-552	CLIP-seq
MIRT796129	hsa-miR-569	CLIP-seq
MIRT796130	hsa-miR-624	CLIP-seq
MIRT796131	hsa-miR-628-3p	CLIP-seq
MIRT796132	hsa-miR-657	CLIP-seq
MIRT796133	hsa-miR-663b	CLIP-seq
MIRT796134	hsa-miR-671-5p	CLIP-seq
MIRT796135	hsa-miR-7	CLIP-seq
MIRT796136	hsa-miR-759	CLIP-seq
MIRT796137	hsa-miR-3121-3p	CLIP-seq
MIRT796138	hsa-miR-3163	CLIP-seq
MIRT796139	hsa-miR-649	CLIP-seq
MIRT1545521	hsa-miR-4728-3p	CLIP-seq
MIRT796059	hsa-miR-4786-3p	CLIP-seq
MIRT1935116	hsa-miR-105	CLIP-seq
MIRT2175087	hsa-let-7a	CLIP-seq
MIRT2175088	hsa-let-7b	CLIP-seq
MIRT2175089	hsa-let-7c	CLIP-seq
MIRT2175090	hsa-let-7d	CLIP-seq
MIRT2175091	hsa-let-7e	CLIP-seq
MIRT2175092	hsa-let-7f	CLIP-seq
MIRT2175093	hsa-let-7g	CLIP-seq
MIRT2175094	hsa-let-7i	CLIP-seq
MIRT2175095	hsa-miR-103a	CLIP-seq
MIRT2175096	hsa-miR-107	CLIP-seq
MIRT2175097	hsa-miR-1184	CLIP-seq
MIRT2175098	hsa-miR-1197	CLIP-seq
MIRT2175099	hsa-miR-1231	CLIP-seq
MIRT2175100	hsa-miR-1244	CLIP-seq
MIRT796072	hsa-miR-1252	CLIP-seq
MIRT2175101	hsa-miR-125a-3p	CLIP-seq
MIRT2175102	hsa-miR-1273f	CLIP-seq
MIRT2175103	hsa-miR-1275	CLIP-seq
MIRT796073	hsa-miR-1281	CLIP-seq
MIRT2175104	hsa-miR-1289	CLIP-seq
MIRT796075	hsa-miR-1324	CLIP-seq
MIRT2175105	hsa-miR-136	CLIP-seq
MIRT2175106	hsa-miR-137	CLIP-seq
MIRT2175107	hsa-miR-140-3p	CLIP-seq
MIRT2175108	hsa-miR-143	CLIP-seq
MIRT2175109	hsa-miR-181a	CLIP-seq
MIRT2175110	hsa-miR-181b	CLIP-seq
MIRT2175111	hsa-miR-181c	CLIP-seq
MIRT2175112	hsa-miR-181d	CLIP-seq
MIRT796077	hsa-miR-185	CLIP-seq
MIRT2175113	hsa-miR-18a	CLIP-seq
MIRT2175114	hsa-miR-18b	CLIP-seq
MIRT2175115	hsa-miR-202	CLIP-seq
MIRT2175116	hsa-miR-219-1-3p	CLIP-seq
MIRT796078	hsa-miR-2467-3p	CLIP-seq
MIRT2175117	hsa-miR-25	CLIP-seq
MIRT2175118	hsa-miR-27a	CLIP-seq
MIRT2175119	hsa-miR-27b	CLIP-seq
MIRT2175120	hsa-miR-298	CLIP-seq
MIRT796079	hsa-miR-300	CLIP-seq
MIRT796081	hsa-miR-3128	CLIP-seq
MIRT796083	hsa-miR-3171	CLIP-seq
MIRT2175121	hsa-miR-3173-3p	CLIP-seq
MIRT796084	hsa-miR-3180	CLIP-seq
MIRT796085	hsa-miR-3180-3p	CLIP-seq
MIRT796086	hsa-miR-3184	CLIP-seq
MIRT796087	hsa-miR-3196	CLIP-seq
MIRT2175122	hsa-miR-32	CLIP-seq
MIRT796089	hsa-miR-325	CLIP-seq
MIRT2175123	hsa-miR-363	CLIP-seq
MIRT2175124	hsa-miR-3663-3p	CLIP-seq
MIRT2175125	hsa-miR-367	CLIP-seq
MIRT2175126	hsa-miR-3678-3p	CLIP-seq
MIRT2175127	hsa-miR-3681	CLIP-seq
MIRT2175128	hsa-miR-3687	CLIP-seq
MIRT796092	hsa-miR-369-3p	CLIP-seq
MIRT796093	hsa-miR-374a	CLIP-seq
MIRT796094	hsa-miR-374b	CLIP-seq
MIRT2175129	hsa-miR-374c	CLIP-seq
MIRT796095	hsa-miR-381	CLIP-seq
MIRT796097	hsa-miR-383	CLIP-seq
MIRT2175130	hsa-miR-3940-3p	CLIP-seq
MIRT2175131	hsa-miR-3978	CLIP-seq
MIRT796102	hsa-miR-423-5p	CLIP-seq
MIRT2175132	hsa-miR-4262	CLIP-seq
MIRT796104	hsa-miR-4306	CLIP-seq
MIRT2175133	hsa-miR-4316	CLIP-seq
MIRT796106	hsa-miR-4326	CLIP-seq
MIRT2175134	hsa-miR-4328	CLIP-seq
MIRT796108	hsa-miR-4420	CLIP-seq
MIRT2175135	hsa-miR-4428	CLIP-seq
MIRT796110	hsa-miR-4436b-3p	CLIP-seq
MIRT2175136	hsa-miR-4442	CLIP-seq
MIRT2175137	hsa-miR-4450	CLIP-seq
MIRT2175138	hsa-miR-4458	CLIP-seq
MIRT2175139	hsa-miR-4477b	CLIP-seq
MIRT2175140	hsa-miR-4500	CLIP-seq
MIRT2175141	hsa-miR-4525	CLIP-seq
MIRT796112	hsa-miR-4533	CLIP-seq
MIRT2175142	hsa-miR-4539	CLIP-seq
MIRT2175143	hsa-miR-4633-5p	CLIP-seq
MIRT796114	hsa-miR-4644	CLIP-seq
MIRT2175144	hsa-miR-4665-5p	CLIP-seq
MIRT2175145	hsa-miR-4685-5p	CLIP-seq
MIRT796120	hsa-miR-4699-3p	CLIP-seq
MIRT796121	hsa-miR-4704-3p	CLIP-seq
MIRT2175146	hsa-miR-4704-5p	CLIP-seq
MIRT2175147	hsa-miR-4708-5p	CLIP-seq
MIRT2175148	hsa-miR-4710	CLIP-seq
MIRT2175149	hsa-miR-4723-5p	CLIP-seq
MIRT796122	hsa-miR-4724-5p	CLIP-seq
MIRT2175150	hsa-miR-4735-3p	CLIP-seq
MIRT2175151	hsa-miR-4757-5p	CLIP-seq
MIRT796125	hsa-miR-4761-5p	CLIP-seq
MIRT2175152	hsa-miR-4770	CLIP-seq
MIRT796059	hsa-miR-4786-3p	CLIP-seq
MIRT2175153	hsa-miR-4792	CLIP-seq
MIRT2175154	hsa-miR-4797-5p	CLIP-seq
MIRT2175155	hsa-miR-494	CLIP-seq
MIRT2175156	hsa-miR-505	CLIP-seq
MIRT796126	hsa-miR-5095	CLIP-seq
MIRT2175157	hsa-miR-513a-5p	CLIP-seq
MIRT2175158	hsa-miR-532-5p	CLIP-seq
MIRT796128	hsa-miR-552	CLIP-seq
MIRT796129	hsa-miR-569	CLIP-seq
MIRT2175159	hsa-miR-571	CLIP-seq
MIRT2175160	hsa-miR-586	CLIP-seq
MIRT2175161	hsa-miR-596	CLIP-seq
MIRT796066	hsa-miR-625	CLIP-seq
MIRT796131	hsa-miR-628-3p	CLIP-seq
MIRT2175162	hsa-miR-655	CLIP-seq
MIRT2175163	hsa-miR-670	CLIP-seq
MIRT796134	hsa-miR-671-5p	CLIP-seq
MIRT796136	hsa-miR-759	CLIP-seq
MIRT2175164	hsa-miR-875-3p	CLIP-seq
MIRT2175165	hsa-miR-92a	CLIP-seq
MIRT2175166	hsa-miR-92b	CLIP-seq
MIRT2175167	hsa-miR-98	CLIP-seq
MIRT2478304	hsa-miR-4719	CLIP-seq
MIRT2478305	hsa-miR-1206	CLIP-seq
MIRT2478306	hsa-miR-1323	CLIP-seq
MIRT2478307	hsa-miR-141	CLIP-seq
MIRT2478308	hsa-miR-146a	CLIP-seq
MIRT2478309	hsa-miR-146b-5p	CLIP-seq
MIRT2478310	hsa-miR-1825	CLIP-seq
MIRT2478311	hsa-miR-200a	CLIP-seq
MIRT2478312	hsa-miR-200b	CLIP-seq
MIRT2478313	hsa-miR-200c	CLIP-seq
MIRT2478314	hsa-miR-2110	CLIP-seq
MIRT2478315	hsa-miR-2116	CLIP-seq
MIRT2478316	hsa-miR-217	CLIP-seq
MIRT2478317	hsa-miR-3064-3p	CLIP-seq
MIRT796137	hsa-miR-3121-3p	CLIP-seq
MIRT2478318	hsa-miR-3130-3p	CLIP-seq
MIRT2478319	hsa-miR-3152-3p	CLIP-seq
MIRT2478320	hsa-miR-3155	CLIP-seq
MIRT2478321	hsa-miR-3155b	CLIP-seq
MIRT796138	hsa-miR-3163	CLIP-seq
MIRT2478322	hsa-miR-345	CLIP-seq
MIRT2478323	hsa-miR-34a	CLIP-seq
MIRT2478324	hsa-miR-34c-5p	CLIP-seq
MIRT2478325	hsa-miR-3647-3p	CLIP-seq
MIRT2478326	hsa-miR-3682-5p	CLIP-seq
MIRT2478327	hsa-miR-3688-5p	CLIP-seq
MIRT2478328	hsa-miR-3713	CLIP-seq
MIRT2478329	hsa-miR-3714	CLIP-seq
MIRT2478330	hsa-miR-378g	CLIP-seq
MIRT796097	hsa-miR-383	CLIP-seq
MIRT2478331	hsa-miR-3922-5p	CLIP-seq
MIRT2478332	hsa-miR-4255	CLIP-seq
MIRT2478333	hsa-miR-4268	CLIP-seq
MIRT2478334	hsa-miR-4271	CLIP-seq
MIRT2478335	hsa-miR-429	CLIP-seq
MIRT2478336	hsa-miR-4418	CLIP-seq
MIRT2478337	hsa-miR-4427	CLIP-seq
MIRT2478338	hsa-miR-4437	CLIP-seq
MIRT2478339	hsa-miR-4448	CLIP-seq
MIRT2478340	hsa-miR-4474-3p	CLIP-seq
MIRT2478341	hsa-miR-4474-5p	CLIP-seq
MIRT2478342	hsa-miR-4480	CLIP-seq
MIRT2478343	hsa-miR-4481	CLIP-seq
MIRT2478344	hsa-miR-449a	CLIP-seq
MIRT2478345	hsa-miR-449b	CLIP-seq
MIRT2478346	hsa-miR-4639-3p	CLIP-seq
MIRT2478347	hsa-miR-4662a-5p	CLIP-seq
MIRT2478348	hsa-miR-4674	CLIP-seq
MIRT2478349	hsa-miR-4676-5p	CLIP-seq
MIRT2478350	hsa-miR-4677-5p	CLIP-seq
MIRT2478351	hsa-miR-4694-5p	CLIP-seq
MIRT2478352	hsa-miR-4707-3p	CLIP-seq
MIRT2478353	hsa-miR-4711-5p	CLIP-seq
MIRT2478304	hsa-miR-4719	CLIP-seq
MIRT2478354	hsa-miR-4722-3p	CLIP-seq
MIRT2478355	hsa-miR-4725-3p	CLIP-seq
MIRT2478356	hsa-miR-4742-5p	CLIP-seq
MIRT2478357	hsa-miR-4745-5p	CLIP-seq
MIRT2478358	hsa-miR-4768-3p	CLIP-seq
MIRT2478359	hsa-miR-4793-3p	CLIP-seq
MIRT2478360	hsa-miR-484	CLIP-seq
MIRT2478361	hsa-miR-485-3p	CLIP-seq
MIRT2478362	hsa-miR-491-5p	CLIP-seq
MIRT2478363	hsa-miR-509-3-5p	CLIP-seq
MIRT2478364	hsa-miR-509-5p	CLIP-seq
MIRT2478365	hsa-miR-511	CLIP-seq
MIRT2478366	hsa-miR-548an	CLIP-seq
MIRT2478367	hsa-miR-548o	CLIP-seq
MIRT2478368	hsa-miR-548t	CLIP-seq
MIRT2478369	hsa-miR-575	CLIP-seq
MIRT2478370	hsa-miR-642b	CLIP-seq
MIRT796139	hsa-miR-649	CLIP-seq
MIRT796136	hsa-miR-759	CLIP-seq
MIRT2478371	hsa-miR-760	CLIP-seq
MIRT2675352	hsa-miR-1250	CLIP-seq
MIRT796074	hsa-miR-1304	CLIP-seq
MIRT2175109	hsa-miR-181a	CLIP-seq
MIRT2175110	hsa-miR-181b	CLIP-seq
MIRT2175111	hsa-miR-181c	CLIP-seq
MIRT2175112	hsa-miR-181d	CLIP-seq
MIRT796079	hsa-miR-300	CLIP-seq
MIRT796080	hsa-miR-3126-5p	CLIP-seq
MIRT796082	hsa-miR-3156-5p	CLIP-seq
MIRT796089	hsa-miR-325	CLIP-seq
MIRT796092	hsa-miR-369-3p	CLIP-seq
MIRT796093	hsa-miR-374a	CLIP-seq
MIRT796094	hsa-miR-374b	CLIP-seq
MIRT2175129	hsa-miR-374c	CLIP-seq
MIRT796095	hsa-miR-381	CLIP-seq
MIRT2675353	hsa-miR-3940-5p	CLIP-seq
MIRT2175132	hsa-miR-4262	CLIP-seq
MIRT796107	hsa-miR-4419a	CLIP-seq
MIRT796110	hsa-miR-4436b-3p	CLIP-seq
MIRT2675354	hsa-miR-4507	CLIP-seq
MIRT796111	hsa-miR-4510	CLIP-seq
MIRT796115	hsa-miR-4666-3p	CLIP-seq
MIRT796120	hsa-miR-4699-3p	CLIP-seq
MIRT796123	hsa-miR-4736	CLIP-seq
MIRT796124	hsa-miR-4753-3p	CLIP-seq
MIRT2675355	hsa-miR-4786-5p	CLIP-seq
MIRT796126	hsa-miR-5095	CLIP-seq
MIRT796128	hsa-miR-552	CLIP-seq
MIRT796131	hsa-miR-628-3p	CLIP-seq
MIRT2675356	hsa-miR-629	CLIP-seq
MIRT2175162	hsa-miR-655	CLIP-seq
MIRT796132	hsa-miR-657	CLIP-seq
MIRT796135	hsa-miR-7	CLIP-seq
MIRT2675357	hsa-miR-769-5p	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	EXP	12695502, 17310244
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	21048939
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11864573, 15182672, 16101281, 16329988, 16374509, 16407834, 16492808, 16628223, 16787945, 16983070, 19041750, 19118189, 19555689, 20395446, 20936779, 21048939, 21295525, 21653829, 23455922, 24550280, 24792722, 25150978, 25416956, 25500533, 26617989, 27012601, 29997244, 31980649, 326
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	27012601
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007030	Process	Golgi organization	IMP	25500533
GO:0007165	Process	Signal transduction	TAS	9659915
GO:0007266	Process	Rho protein signal transduction	IMP	25500533
GO:0007399	Process	Nervous system development	IEA
GO:0010763	Process	Positive regulation of fibroblast migration	HDA	21423176
GO:0019901	Function	Protein kinase binding	IPI	21048939
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030032	Process	Lamellipodium assembly	IBA
GO:0030032	Process	Lamellipodium assembly	ISS
GO:0032991	Component	Protein-containing complex	IDA	11864573
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	21048939
GO:0043015	Function	Gamma-tubulin binding	IDA	27012601
GO:0043025	Component	Neuronal cell body	IDA	21048939
GO:0043065	Process	Positive regulation of apoptotic process	IMP	19041750
GO:0043547	Process	Positive regulation of GTPase activity	HMP	21423176
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048041	Process	Focal adhesion assembly	HDA	21423176
GO:0070161	Component	Anchoring junction	IEA
GO:0097431	Component	Mitotic spindle pole	IDA	27012601
GO:0098794	Component	Postsynapse	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	HMP	21423176
GO:1905833	Process	Negative regulation of microtubule nucleation	IMP	27012601
GO:2000394	Process	Positive regulation of lamellipodium morphogenesis	HMP	21423176

MIM	HGNC	e!Ensembl
605477	15607	ENSG00000102606

Q14155

Protein name

Rho guanine nucleotide exchange factor 7 (Beta-Pix) (COOL-1) (PAK-interacting exchange factor beta) (p85)

Protein function

Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions (By similarity). May function as a positive regul

PDB

1BY1 , 1ZSG , 2L3G , 5SXP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00307	CH	1 → 91	Calponin homology (CH) domain	Domain
PF16615	RhoGEF67_u1	138 → 184		Disordered
PF07653	SH3_2	188 → 241	Variant SH3 domain	Domain
PF00621	RhoGEF	275 → 449	RhoGEF domain	Domain
PF00169	PH	478 → 578	PH domain	Domain
PF16614	RhoGEF67_u2	632 → 732		Disordered

Sequence

MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSH
PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPP
LRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIW
TAHSYRMGSTSRKSCCSYISHQN

Sequence length

803

Interactions

View interactions

	KEGG		Reactome
	Regulation of actin cytoskeleton Yersinia infection		EGFR downregulation NRAGE signals death through JNK Rho GTPase cycle Ephrin signaling G alpha (12/13) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY OF PREMATURITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (228)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
2-3 toe syndactyly	Syndactyly Of The Toes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	26279205		★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH Syndrome, Ectopic	Ectopic ACTH secretion syndrome	BEFREE	20960100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21750116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30132516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25683605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28281555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26988706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	GENOMICS_ENGLAND_DG	12884430, 24556213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31843706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24345324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22087847, 27512062		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27454293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	17853471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	12868372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11381677, 12005399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	17853471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31649298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31260720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31378910, 31635187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15625200, 16823804, 17123476, 17224092, 18189279, 18545269, 29981961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	24339136, 31536946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borjeson-Forssman-Lehmann syndrome	Borjeson-Forssman-Lehmann Syndrome	BEFREE	11337747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15481028, 16579640, 23222510, 28027535, 29423058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25425573, 31987914, 35085554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	24339136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	40028213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17145890, 29169729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	18025535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18675321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28126652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29807004		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17098279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17098279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22623730, 25922067, 26062845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18635891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	18805672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	15574732, 16262206, 31780341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17853471, 18805672, 34014906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19509257, 26864651, 7541019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29588321, 31217502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22761953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24966994, 34582006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	26279205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31843706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23671649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23671649, 24818816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23671649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	9928378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	19095643, 31463646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28482921, 30316071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32050918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29669934, 30581781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29669934, 30581781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28281555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31410926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal dysplasia, hypohidrotic, with immune deficiency	Ectodermal Dysplasia	BEFREE	18523147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22711307, 26293665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	19444485, 29246092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	29734022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	29734022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	17952198, 19336760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17425403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29550933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial erythrocytosis	Erythrocytosis	BEFREE	17952198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	25356681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	12579020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	17145890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29743985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31697709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	30138396, 31306362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18328427, 23563176, 24458840, 26663363, 30030559, 30940658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18328427, 23563176, 24458840, 26663363, 30030559, 30940658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22810421, 30030559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29953879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gross motor development delay	Developmental delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29496059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	19295544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11376869, 11986952, 26988706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	17853471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31843706		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDROCEPHALUS, NONSYNDROMIC, AUTOSOMAL RECESSIVE 1	Hydrocephalus	BEFREE	31843706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30151392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28732058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32858793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18635891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	34014906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	15574732, 16262206, 18805672, 29202656, 31780341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28766916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	10493832, 10946356, 11017088, 12884430, 15574732, 17853471, 18203171, 18523455, 18805672, 22238087, 22815483, 27940202, 28126652, 29246092, 31843706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	17853471, 18805672, 28481730, 29734022, 32050918, 34014906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24469048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis	Keratoconjunctivitis	BEFREE	27216851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16123212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29669934		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31633499, 8912525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15161671, 16254192, 23660386, 28699225, 31752577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28699225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25683605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	3430520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	3430520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16219794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	11986952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	28126652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	23360674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9538131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29496059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15481028, 17369819, 23222510, 28027535, 29423058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22711307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15598214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1310887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16998793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17145890, 29169729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25611381, 31051214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11155740, 12727841, 28012929, 28614092, 31428587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12527907, 16131837, 16254192, 23270540, 25404639, 27454293, 27827005, 28181923, 28549179, 28630349, 28670959, 28743532, 29246942, 29588321, 29616047 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17098279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19509257, 26864651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10713699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel Diverticulum	Meckel Diverticulum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19574933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	17014995, 29202656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10493832, 12884430, 15574732, 17853471, 18203171, 18523455, 18805672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	LHGDN	15574732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	18523455, 9332663, 9731525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 1	Mental Retardation, X-Linked	BEFREE	12949969, 15574732, 9731525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 1	Mental Retardation, X-Linked	ORPHANET_DG	18523455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 30	Mental retardation	UNIPROT_DG	10946356, 12884430, 9731525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 30	Mental retardation	GENOMICS_ENGLAND_DG	12884430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 30	Mental retardation	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 30	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28223140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24555840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22689055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	17853471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	18203171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28550252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	BEFREE	29734022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild neurosensory hearing impairment	Neurosensory Hearing impairment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	9857977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	16917511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19286672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	7672091		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	29588321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19168865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	14678988, 29409973, 30662656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11825668, 16917505, 17425403, 20009901, 22761754, 23437404, 24114584, 24458840, 27130196, 27827005, 28823542, 29508276, 29588321, 29588411, 30014762 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	18445079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24075941, 8428579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19036346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20960100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28699225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24550137, 7675461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15625200, 17123476, 17514428, 18189279, 18805672, 20102668, 21655260, 22588665, 24339136, 31111773, 31649298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28479334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29342124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	31306362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19151744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	26178921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	17145890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29296226		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29169729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25611381, 31051214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27454293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30794721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARTINGTON X-LINKED MENTAL RETARDATION SYNDROME	Partington syndrome	CLINGEN_DG	10946356, 12884430, 16014725, 17537723, 17853471, 18523455, 24556213, 25666757, 28126652, 28481730, 29246092, 9731525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	30695788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16123212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perry Syndrome	Perry Syndrome	BEFREE	28789478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11440917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	17952198, 19295544, 19336760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	18793248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11155740, 12727841, 15498932, 28012929, 28614092, 31428587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31515456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	15625200, 17123476, 17514428, 18189279, 18805672, 20102668, 21655260, 22588665, 24339136, 31111773, 31649298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	18805672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	24465776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29288416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34014906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11884470, 29022182, 3261054, 8310203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective disorder, bipolar type	Schizoaffective Disorder	BEFREE	17192894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10206241, 10394470, 10618013, 10813805, 11803513, 11803515, 11803532, 12399955, 12450949, 12685995, 1450287, 14569275, 15038993, 15100704, 15465979 View all (51 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	6593111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33168071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22408080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	10946356, 31843706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	16219794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	17040605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	BEFREE	28126652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	31019235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26435503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30250646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	15200413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	15200413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36418900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	6593111		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19395464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28471449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24526373, 30014762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	29588321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	9928378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30225173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25615606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	39892202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked non-syndromic intellectual disability	Non-Syndromic Intellectual Disability, X-Linked	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGEF7 (Rho guanine nucleotide exchange factor 7)