CCKBR (cholecystokinin B receptor)

Gene

• Entrez ID: 887
• Gene name: Cholecystokinin B receptor
• Gene symbol: CCKBR
• Synonyms (NCBI Gene): CCK-2R, CCK-B, CCK2R, GASR
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005759	hsa-miR-148b-3p	Luciferase reporter assay	21205300
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, Microarray	21168126
MIRT005759	hsa-miR-148b-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22020560
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23975374
MIRT005898	hsa-miR-148a-3p	qRT-PCR, Western blot	20422307
MIRT053380	hsa-miR-152-3p	qRT-PCR, Western blot	20422307
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT005898	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27518872
MIRT870845	hsa-miR-1231	CLIP-seq
MIRT870846	hsa-miR-1299	CLIP-seq
MIRT870847	hsa-miR-148a	CLIP-seq
MIRT870848	hsa-miR-148b	CLIP-seq
MIRT870849	hsa-miR-152	CLIP-seq
MIRT870850	hsa-miR-298	CLIP-seq
MIRT870851	hsa-miR-3185	CLIP-seq
MIRT870852	hsa-miR-3202	CLIP-seq
MIRT870853	hsa-miR-4276	CLIP-seq
MIRT870854	hsa-miR-4533	CLIP-seq
MIRT870855	hsa-miR-4697-3p	CLIP-seq
MIRT870856	hsa-miR-4773	CLIP-seq
MIRT870857	hsa-miR-548b-3p	CLIP-seq
MIRT870858	hsa-miR-616	CLIP-seq
MIRT870859	hsa-miR-875-3p	CLIP-seq
MIRT1546244	hsa-miR-202	CLIP-seq
MIRT1546245	hsa-miR-4257	CLIP-seq
MIRT870847	hsa-miR-148a	CLIP-seq
MIRT870848	hsa-miR-148b	CLIP-seq
MIRT870849	hsa-miR-152	CLIP-seq
MIRT870853	hsa-miR-4276	CLIP-seq
MIRT1958597	hsa-miR-509-3p	CLIP-seq
MIRT1958598	hsa-miR-512-3p	CLIP-seq
MIRT1958599	hsa-miR-592	CLIP-seq
MIRT1958600	hsa-miR-597	CLIP-seq
MIRT870847	hsa-miR-148a	CLIP-seq
MIRT870848	hsa-miR-148b	CLIP-seq
MIRT870849	hsa-miR-152	CLIP-seq
MIRT1546245	hsa-miR-4257	CLIP-seq
MIRT870853	hsa-miR-4276	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001696	Process	Gastric acid secretion	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004951	Function	Cholecystokinin receptor activity	IBA
GO:0004951	Function	Cholecystokinin receptor activity	IDA	7681836
GO:0005515	Function	Protein binding	IPI	16963136, 23597562, 25416956
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	10913157
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	7681836
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8455720
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	10913157
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10913157
GO:0015054	Function	Gastrin receptor activity	IBA
GO:0015054	Function	Gastrin receptor activity	IDA	7681836, 10913157
GO:0015054	Function	Gastrin receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IPI	7681836
GO:0031741	Function	Type B gastrin/cholecystokinin receptor binding	IDA	1280419, 8185642
GO:0038188	Process	Cholecystokinin signaling pathway	IDA	7681836
GO:0045851	Process	PH reduction	IEA
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	TAS	10400698
GO:0048565	Process	Digestive tract development	IEA
GO:0048732	Process	Gland development	IEA

Other IDs

• MIM: 118445
• HGNC: 1571
• e!Ensembl: ENSG00000110148

Protein

• UniProt ID: P32239
• Protein name: Gastrin/cholecystokinin type B receptor (CCK-B receptor) (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R)
• Protein function: Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins
• PDB: 1L4T, 7F8V, 7F8W, 7XOW, 8IA7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	71 → 390	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at hig
• Sequence:

  MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
  YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
  IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
  LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
  ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
  RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
  PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
  PDEDPPTPSIASLSRLSYTTISTLGPG

• Sequence length: 447

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Gastric acid secretion

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
Gastrin-CREB signalling pathway via PKC and MAPK

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	10749330, 17584144, 28109268		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20118543, 26646278		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12189558, 19697327		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	12189558		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	22593272		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31313401		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	22414867, 28413930, 31308730, 31526831		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	28413930	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22414867, 28413930, 31308730, 31526831		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23975374		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27448962		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30115027		★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	11751073		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11896205, 15929170, 25752269, 26508021, 36871090	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	18719002, 26910279	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12851875, 15040018, 23544442, 7593130		★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	7928627	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11830556, 15655524, 16051276, 16143134, 16998832		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11076881, 26508021, 7928627	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12761477, 16143134, 16998832, 17936921		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19652364, 9296339		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	11076881	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11589724, 12353842, 19652364, 20600355, 22020560, 7593130		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15292208, 15655524, 17167838, 19627395, 34740325, 35722465	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11773861		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11773861		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11773861		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	33608531	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18438722	Associate	★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	11751073		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	27448962		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	36871090	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	15040018, 23053898, 30382864		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	30382864	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	17584143, 27323780		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	11896205, 20932834, 9691917	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	16909104		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22786615		★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	12657185		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	12353842		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	9296339		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16142371		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8839863	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17088981		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19627395		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19627395	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26910279	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30115027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11444473, 15292208, 21839751, 22277584, 22442157, 23975374, 25469546, 26646278, 27072272, 31313401		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24211650		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15040018, 20422307, 22516348, 23311704, 27072272, 28980157, 8844981		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12353842, 12955087, 15040018, 16909104, 17584143, 22442157, 29849512, 30108868, 30530828, 31314031		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15655524, 16051276, 16143134, 16998832		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10452322, 11751073, 30002107, 30530828, 31519804		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16242076		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38069171	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15980969		★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	20185366		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10452322, 11751073, 11830556, 12189558, 12353842, 12955087, 14759564, 14764072, 16909104, 17584144, 18310296, 19502590, 19627395, 19697327, 20198494, 22040601, 22786615, 23311704, 23544442, 24211650, 28109268, 28702751, 28728415, 28980157, 29896292, 30059514, 9296339, 9679761, 9920090		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28980157		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11773861		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	CTD_human_DG	8878350		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26910279	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11444473, 11830556, 21839751, 22277584, 22442157, 23975374, 25469546, 26646278, 27072272, 31313401		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27754762, 31313401		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15682471, 22277584, 23975374, 25469546, 26646278, 9239407	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22442157	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27072272	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12851875		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	CTD_human_DG	8878350		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	10395221, 11244486, 11344357, 11515749, 11803530, 15354400, 20023595, 22414867, 22553078, 8837709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	LHGDN	15354400		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	CTD_human_DG	8878350		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	12777967		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	33608531	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24211650		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30840133		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10581492, 11803530		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	8221657		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	7928627	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15040018, 15929170, 20422307, 23311704, 27072272, 8844981, 9458369		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11192946, 18719002, 20150185, 23121767, 27072272, 28109268, 30607886, 8662934	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15040018, 16012719, 17962809		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15929170	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	26884118, 36657979	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22040601		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	14759564		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26910279	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	26910279	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	28936718		★☆☆☆☆ Found in Text Mining only
Zollinger-Ellison syndrome	Zollinger-Ellison syndrome	BEFREE	17584143		★☆☆☆☆ Found in Text Mining only