PER3 (period circadian regulator 3)

Gene

• Entrez ID: 8863
• Gene name: Period circadian regulator 3
• Gene symbol: PER3
• Synonyms (NCBI Gene): FASPS3, GIG13
• Chromosome: 1
• Chromosome location: 1p36.23
• Summary: This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomoto

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs139315125	A>G	Pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs150812083	C>G	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1558401132	CTTGC>-	Likely-pathogenic	Frameshift variant, 5 prime UTR variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029909	hsa-miR-26b-5p	Microarray	19088304
MIRT030960	hsa-miR-21-5p	Microarray	18591254
MIRT487823	hsa-miR-320e	PAR-CLIP	23592263
MIRT487822	hsa-miR-3943	PAR-CLIP	23592263
MIRT487821	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT487819	hsa-miR-4787-5p	PAR-CLIP	23592263
MIRT487820	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT487818	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT487817	hsa-miR-8089	PAR-CLIP	23592263
MIRT487816	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT487815	hsa-miR-4313	PAR-CLIP	23592263
MIRT487814	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT487813	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487811	hsa-miR-8085	PAR-CLIP	23592263
MIRT487812	hsa-miR-3175	PAR-CLIP	23592263
MIRT487810	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT487809	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT487808	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487807	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT487806	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT487805	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT487804	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT440003	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT440002	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT440003	hsa-miR-154-5p	HITS-CLIP	24374217
MIRT440002	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT487816	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT487816	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT487810	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT487810	hsa-miR-1343-5p	PAR-CLIP	26701625
MIRT487805	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT487805	hsa-miR-3150a-3p	PAR-CLIP	26701625
MIRT487812	hsa-miR-3175	PAR-CLIP	26701625
MIRT487812	hsa-miR-3175	PAR-CLIP	26701625
MIRT487807	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT487807	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT487822	hsa-miR-3943	PAR-CLIP	26701625
MIRT487822	hsa-miR-3943	PAR-CLIP	26701625
MIRT487815	hsa-miR-4313	PAR-CLIP	26701625
MIRT487815	hsa-miR-4313	PAR-CLIP	26701625
MIRT487820	hsa-miR-4667-5p	PAR-CLIP	26701625
MIRT487820	hsa-miR-4667-5p	PAR-CLIP	26701625
MIRT487818	hsa-miR-4700-5p	PAR-CLIP	26701625
MIRT487818	hsa-miR-4700-5p	PAR-CLIP	26701625
MIRT487814	hsa-miR-4731-5p	PAR-CLIP	26701625
MIRT487814	hsa-miR-4731-5p	PAR-CLIP	26701625
MIRT487819	hsa-miR-4787-5p	PAR-CLIP	26701625
MIRT487819	hsa-miR-4787-5p	PAR-CLIP	26701625
MIRT487813	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT487813	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT487804	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT487804	hsa-miR-6763-5p	PAR-CLIP	26701625
MIRT487821	hsa-miR-6795-3p	PAR-CLIP	26701625
MIRT487821	hsa-miR-6795-3p	PAR-CLIP	26701625
MIRT487808	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT487808	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT487806	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT487806	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT487811	hsa-miR-8085	PAR-CLIP	26701625
MIRT487811	hsa-miR-8085	PAR-CLIP	26701625
MIRT487817	hsa-miR-8089	PAR-CLIP	26701625
MIRT487817	hsa-miR-8089	PAR-CLIP	26701625
MIRT487809	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT487809	hsa-miR-939-5p	PAR-CLIP	26701625
MIRT487823	hsa-miR-320e	PAR-CLIP	23592263
MIRT487822	hsa-miR-3943	PAR-CLIP	23592263
MIRT487821	hsa-miR-6795-3p	PAR-CLIP	23592263
MIRT487819	hsa-miR-4787-5p	PAR-CLIP	23592263
MIRT487820	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT487818	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT487817	hsa-miR-8089	PAR-CLIP	23592263
MIRT487816	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT487815	hsa-miR-4313	PAR-CLIP	23592263
MIRT487814	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT487813	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487811	hsa-miR-8085	PAR-CLIP	23592263
MIRT487812	hsa-miR-3175	PAR-CLIP	23592263
MIRT487810	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT487809	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT487808	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487807	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT487806	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT487805	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT487804	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1225121	hsa-miR-1	CLIP-seq
MIRT1225122	hsa-miR-10a	CLIP-seq
MIRT1225123	hsa-miR-10b	CLIP-seq
MIRT1225124	hsa-miR-1205	CLIP-seq
MIRT1225125	hsa-miR-1254	CLIP-seq
MIRT1225126	hsa-miR-1283	CLIP-seq
MIRT1225127	hsa-miR-1286	CLIP-seq
MIRT1225128	hsa-miR-134	CLIP-seq
MIRT1225129	hsa-miR-181a	CLIP-seq
MIRT1225130	hsa-miR-181b	CLIP-seq
MIRT1225131	hsa-miR-181c	CLIP-seq
MIRT1225132	hsa-miR-181d	CLIP-seq
MIRT1225133	hsa-miR-193a-3p	CLIP-seq
MIRT1225134	hsa-miR-193b	CLIP-seq
MIRT1225135	hsa-miR-206	CLIP-seq
MIRT1225136	hsa-miR-3064-5p	CLIP-seq
MIRT1225137	hsa-miR-3116	CLIP-seq
MIRT1225138	hsa-miR-3118	CLIP-seq
MIRT1225139	hsa-miR-3131	CLIP-seq
MIRT1225140	hsa-miR-3134	CLIP-seq
MIRT1225141	hsa-miR-3136-5p	CLIP-seq
MIRT1225142	hsa-miR-3143	CLIP-seq
MIRT1225143	hsa-miR-3153	CLIP-seq
MIRT1225144	hsa-miR-3652	CLIP-seq
MIRT1225145	hsa-miR-3662	CLIP-seq
MIRT1225146	hsa-miR-3690	CLIP-seq
MIRT1225147	hsa-miR-377	CLIP-seq
MIRT1225148	hsa-miR-378g	CLIP-seq
MIRT1225149	hsa-miR-3936	CLIP-seq
MIRT1225150	hsa-miR-4262	CLIP-seq
MIRT1225151	hsa-miR-4265	CLIP-seq
MIRT1225152	hsa-miR-4272	CLIP-seq
MIRT1225153	hsa-miR-4296	CLIP-seq
MIRT1225154	hsa-miR-4322	CLIP-seq
MIRT1225155	hsa-miR-4417	CLIP-seq
MIRT1225156	hsa-miR-4430	CLIP-seq
MIRT1225157	hsa-miR-4437	CLIP-seq
MIRT1225158	hsa-miR-4439	CLIP-seq
MIRT1225159	hsa-miR-4496	CLIP-seq
MIRT1225160	hsa-miR-4505	CLIP-seq
MIRT1225161	hsa-miR-4513	CLIP-seq
MIRT1225162	hsa-miR-4521	CLIP-seq
MIRT1225163	hsa-miR-4534	CLIP-seq
MIRT1225164	hsa-miR-4649-5p	CLIP-seq
MIRT1225165	hsa-miR-4668-5p	CLIP-seq
MIRT1225166	hsa-miR-4674	CLIP-seq
MIRT1225167	hsa-miR-4722-5p	CLIP-seq
MIRT1225168	hsa-miR-4725-5p	CLIP-seq
MIRT1225169	hsa-miR-494	CLIP-seq
MIRT1225170	hsa-miR-504	CLIP-seq
MIRT1225171	hsa-miR-520d-5p	CLIP-seq
MIRT1225172	hsa-miR-524-5p	CLIP-seq
MIRT1225173	hsa-miR-539	CLIP-seq
MIRT1225174	hsa-miR-543	CLIP-seq
MIRT1225175	hsa-miR-548c-3p	CLIP-seq
MIRT1225176	hsa-miR-549	CLIP-seq
MIRT1225177	hsa-miR-596	CLIP-seq
MIRT1225178	hsa-miR-611	CLIP-seq
MIRT1225179	hsa-miR-613	CLIP-seq
MIRT1225180	hsa-miR-889	CLIP-seq
MIRT1225181	hsa-miR-892b	CLIP-seq
MIRT2065647	hsa-miR-1185	CLIP-seq
MIRT2065648	hsa-miR-1193	CLIP-seq
MIRT2065649	hsa-miR-1225-5p	CLIP-seq
MIRT2065650	hsa-miR-1255a	CLIP-seq
MIRT2065651	hsa-miR-1255b	CLIP-seq
MIRT1225126	hsa-miR-1283	CLIP-seq
MIRT2065652	hsa-miR-1297	CLIP-seq
MIRT1225129	hsa-miR-181a	CLIP-seq
MIRT1225130	hsa-miR-181b	CLIP-seq
MIRT1225131	hsa-miR-181c	CLIP-seq
MIRT1225132	hsa-miR-181d	CLIP-seq
MIRT2065653	hsa-miR-194	CLIP-seq
MIRT2065654	hsa-miR-2392	CLIP-seq
MIRT2065655	hsa-miR-2467-5p	CLIP-seq
MIRT2065656	hsa-miR-2681	CLIP-seq
MIRT2065657	hsa-miR-2682	CLIP-seq
MIRT2065658	hsa-miR-26a	CLIP-seq
MIRT2065659	hsa-miR-26b	CLIP-seq
MIRT2065660	hsa-miR-29a	CLIP-seq
MIRT2065661	hsa-miR-29b	CLIP-seq
MIRT2065662	hsa-miR-29c	CLIP-seq
MIRT2065663	hsa-miR-30a	CLIP-seq
MIRT2065664	hsa-miR-30b	CLIP-seq
MIRT2065665	hsa-miR-30c	CLIP-seq
MIRT2065666	hsa-miR-30d	CLIP-seq
MIRT2065667	hsa-miR-30e	CLIP-seq
MIRT2065668	hsa-miR-3120-5p	CLIP-seq
MIRT2065669	hsa-miR-3135b	CLIP-seq
MIRT1225142	hsa-miR-3143	CLIP-seq
MIRT2065670	hsa-miR-3149	CLIP-seq
MIRT1225143	hsa-miR-3153	CLIP-seq
MIRT2065671	hsa-miR-3158-3p	CLIP-seq
MIRT2065672	hsa-miR-3160-3p	CLIP-seq
MIRT2065673	hsa-miR-3188	CLIP-seq
MIRT2065674	hsa-miR-3200-5p	CLIP-seq
MIRT2065675	hsa-miR-3202	CLIP-seq
MIRT2065676	hsa-miR-320a	CLIP-seq
MIRT2065677	hsa-miR-320b	CLIP-seq
MIRT2065678	hsa-miR-320c	CLIP-seq
MIRT2065679	hsa-miR-320d	CLIP-seq
MIRT2065680	hsa-miR-34a	CLIP-seq
MIRT2065681	hsa-miR-34c-5p	CLIP-seq
MIRT2065682	hsa-miR-3605-5p	CLIP-seq
MIRT2065683	hsa-miR-3607-3p	CLIP-seq
MIRT2065684	hsa-miR-361-5p	CLIP-seq
MIRT2065685	hsa-miR-3646	CLIP-seq
MIRT1225144	hsa-miR-3652	CLIP-seq
MIRT2065686	hsa-miR-3658	CLIP-seq
MIRT2065687	hsa-miR-3679-5p	CLIP-seq
MIRT2065688	hsa-miR-3685	CLIP-seq
MIRT2065689	hsa-miR-3714	CLIP-seq
MIRT2065690	hsa-miR-384	CLIP-seq
MIRT2065691	hsa-miR-3975	CLIP-seq
MIRT2065692	hsa-miR-3978	CLIP-seq
MIRT2065693	hsa-miR-4256	CLIP-seq
MIRT2065694	hsa-miR-4260	CLIP-seq
MIRT1225150	hsa-miR-4262	CLIP-seq
MIRT2065695	hsa-miR-4270	CLIP-seq
MIRT2065696	hsa-miR-4283	CLIP-seq
MIRT2065697	hsa-miR-4303	CLIP-seq
MIRT2065698	hsa-miR-4420	CLIP-seq
MIRT2065699	hsa-miR-4426	CLIP-seq
MIRT2065700	hsa-miR-4428	CLIP-seq
MIRT2065701	hsa-miR-4429	CLIP-seq
MIRT1225156	hsa-miR-4430	CLIP-seq
MIRT2065702	hsa-miR-4436a	CLIP-seq
MIRT2065703	hsa-miR-4441	CLIP-seq
MIRT2065704	hsa-miR-4446-3p	CLIP-seq
MIRT2065705	hsa-miR-4464	CLIP-seq
MIRT2065706	hsa-miR-4465	CLIP-seq
MIRT2065707	hsa-miR-4487	CLIP-seq
MIRT2065708	hsa-miR-4489	CLIP-seq
MIRT2065709	hsa-miR-4492	CLIP-seq
MIRT1225159	hsa-miR-4496	CLIP-seq
MIRT2065710	hsa-miR-4498	CLIP-seq
MIRT2065711	hsa-miR-449a	CLIP-seq
MIRT2065712	hsa-miR-449b	CLIP-seq
MIRT2065713	hsa-miR-449c	CLIP-seq
MIRT2065714	hsa-miR-4528	CLIP-seq
MIRT2065715	hsa-miR-4533	CLIP-seq
MIRT2065716	hsa-miR-4536	CLIP-seq
MIRT2065717	hsa-miR-4647	CLIP-seq
MIRT2065718	hsa-miR-4662b	CLIP-seq
MIRT2065719	hsa-miR-4666-3p	CLIP-seq
MIRT1225165	hsa-miR-4668-5p	CLIP-seq
MIRT2065720	hsa-miR-4670-5p	CLIP-seq
MIRT2065721	hsa-miR-4683	CLIP-seq
MIRT2065722	hsa-miR-4684-5p	CLIP-seq
MIRT2065723	hsa-miR-4693-3p	CLIP-seq
MIRT2065724	hsa-miR-4729	CLIP-seq
MIRT2065725	hsa-miR-4748	CLIP-seq
MIRT2065726	hsa-miR-485-5p	CLIP-seq
MIRT2065727	hsa-miR-488	CLIP-seq
MIRT2065728	hsa-miR-490-5p	CLIP-seq
MIRT1225174	hsa-miR-543	CLIP-seq
MIRT2065729	hsa-miR-548a-3p	CLIP-seq
MIRT2065730	hsa-miR-548e	CLIP-seq
MIRT2065731	hsa-miR-548f	CLIP-seq
MIRT2065732	hsa-miR-548n	CLIP-seq
MIRT2065733	hsa-miR-548t	CLIP-seq
MIRT2065734	hsa-miR-555	CLIP-seq
MIRT2065735	hsa-miR-558	CLIP-seq
MIRT2065736	hsa-miR-568	CLIP-seq
MIRT2065737	hsa-miR-607	CLIP-seq
MIRT2065738	hsa-miR-610	CLIP-seq
MIRT2065739	hsa-miR-624	CLIP-seq
MIRT2065740	hsa-miR-665	CLIP-seq
MIRT2065741	hsa-miR-762	CLIP-seq
MIRT2065742	hsa-miR-942	CLIP-seq
MIRT2293465	hsa-miR-1256	CLIP-seq
MIRT2293466	hsa-miR-1273c	CLIP-seq
MIRT1225129	hsa-miR-181a	CLIP-seq
MIRT1225130	hsa-miR-181b	CLIP-seq
MIRT1225131	hsa-miR-181c	CLIP-seq
MIRT1225132	hsa-miR-181d	CLIP-seq
MIRT2293467	hsa-miR-192	CLIP-seq
MIRT2293468	hsa-miR-215	CLIP-seq
MIRT2065660	hsa-miR-29a	CLIP-seq
MIRT2065661	hsa-miR-29b	CLIP-seq
MIRT2065662	hsa-miR-29c	CLIP-seq
MIRT2293469	hsa-miR-3145-5p	CLIP-seq
MIRT2293470	hsa-miR-3660	CLIP-seq
MIRT2293471	hsa-miR-3671	CLIP-seq
MIRT2293472	hsa-miR-3683	CLIP-seq
MIRT2293473	hsa-miR-3688-3p	CLIP-seq
MIRT1225149	hsa-miR-3936	CLIP-seq
MIRT2065693	hsa-miR-4256	CLIP-seq
MIRT2293474	hsa-miR-4261	CLIP-seq
MIRT1225150	hsa-miR-4262	CLIP-seq
MIRT2293475	hsa-miR-4277	CLIP-seq
MIRT2065699	hsa-miR-4426	CLIP-seq
MIRT1225162	hsa-miR-4521	CLIP-seq
MIRT2293476	hsa-miR-4526	CLIP-seq
MIRT2293477	hsa-miR-4645-3p	CLIP-seq
MIRT2065717	hsa-miR-4647	CLIP-seq
MIRT2293478	hsa-miR-4659a-3p	CLIP-seq
MIRT2293479	hsa-miR-4659b-3p	CLIP-seq
MIRT2065718	hsa-miR-4662b	CLIP-seq
MIRT2293480	hsa-miR-4666-5p	CLIP-seq
MIRT2293481	hsa-miR-4762-5p	CLIP-seq
MIRT2293482	hsa-miR-4797-5p	CLIP-seq
MIRT2065728	hsa-miR-490-5p	CLIP-seq
MIRT2293483	hsa-miR-498	CLIP-seq
MIRT2293484	hsa-miR-508-5p	CLIP-seq
MIRT2293485	hsa-miR-570	CLIP-seq
MIRT2065737	hsa-miR-607	CLIP-seq
MIRT1225180	hsa-miR-889	CLIP-seq
MIRT2293486	hsa-miR-944	CLIP-seq
MIRT2065699	hsa-miR-4426	CLIP-seq
MIRT2065717	hsa-miR-4647	CLIP-seq
MIRT2065718	hsa-miR-4662b	CLIP-seq
MIRT2065647	hsa-miR-1185	CLIP-seq
MIRT2065648	hsa-miR-1193	CLIP-seq
MIRT2591523	hsa-miR-124	CLIP-seq
MIRT2065650	hsa-miR-1255a	CLIP-seq
MIRT2065651	hsa-miR-1255b	CLIP-seq
MIRT2591524	hsa-miR-1261	CLIP-seq
MIRT2293466	hsa-miR-1273c	CLIP-seq
MIRT1225133	hsa-miR-193a-3p	CLIP-seq
MIRT1225134	hsa-miR-193b	CLIP-seq
MIRT2065654	hsa-miR-2392	CLIP-seq
MIRT2065656	hsa-miR-2681	CLIP-seq
MIRT2065660	hsa-miR-29a	CLIP-seq
MIRT2065661	hsa-miR-29b	CLIP-seq
MIRT2065662	hsa-miR-29c	CLIP-seq
MIRT1225136	hsa-miR-3064-5p	CLIP-seq
MIRT2293469	hsa-miR-3145-5p	CLIP-seq
MIRT2591525	hsa-miR-3148	CLIP-seq
MIRT2065674	hsa-miR-3200-5p	CLIP-seq
MIRT2065682	hsa-miR-3605-5p	CLIP-seq
MIRT1225144	hsa-miR-3652	CLIP-seq
MIRT2065686	hsa-miR-3658	CLIP-seq
MIRT2293471	hsa-miR-3671	CLIP-seq
MIRT2065687	hsa-miR-3679-5p	CLIP-seq
MIRT2293472	hsa-miR-3683	CLIP-seq
MIRT2293473	hsa-miR-3688-3p	CLIP-seq
MIRT2591526	hsa-miR-369-3p	CLIP-seq
MIRT2065689	hsa-miR-3714	CLIP-seq
MIRT2591527	hsa-miR-374c	CLIP-seq
MIRT1225147	hsa-miR-377	CLIP-seq
MIRT2591528	hsa-miR-3910	CLIP-seq
MIRT2591529	hsa-miR-3942-3p	CLIP-seq
MIRT2293475	hsa-miR-4277	CLIP-seq
MIRT2065697	hsa-miR-4303	CLIP-seq
MIRT2065698	hsa-miR-4420	CLIP-seq
MIRT2065699	hsa-miR-4426	CLIP-seq
MIRT2065700	hsa-miR-4428	CLIP-seq
MIRT1225156	hsa-miR-4430	CLIP-seq
MIRT2591530	hsa-miR-4432	CLIP-seq
MIRT1225160	hsa-miR-4505	CLIP-seq
MIRT2591531	hsa-miR-4639-5p	CLIP-seq
MIRT2591532	hsa-miR-4641	CLIP-seq
MIRT2293477	hsa-miR-4645-3p	CLIP-seq
MIRT2065717	hsa-miR-4647	CLIP-seq
MIRT2591533	hsa-miR-4662a-3p	CLIP-seq
MIRT2065718	hsa-miR-4662b	CLIP-seq
MIRT2065721	hsa-miR-4683	CLIP-seq
MIRT2065722	hsa-miR-4684-5p	CLIP-seq
MIRT2591534	hsa-miR-4738-3p	CLIP-seq
MIRT2591535	hsa-miR-4747-3p	CLIP-seq
MIRT2293481	hsa-miR-4762-5p	CLIP-seq
MIRT2065727	hsa-miR-488	CLIP-seq
MIRT2065728	hsa-miR-490-5p	CLIP-seq
MIRT2591536	hsa-miR-499-5p	CLIP-seq
MIRT2591537	hsa-miR-506	CLIP-seq
MIRT2293484	hsa-miR-508-5p	CLIP-seq
MIRT2591538	hsa-miR-548ad	CLIP-seq
MIRT2591539	hsa-miR-548p	CLIP-seq
MIRT2065737	hsa-miR-607	CLIP-seq
MIRT2065738	hsa-miR-610	CLIP-seq
MIRT2591540	hsa-miR-655	CLIP-seq
MIRT1225181	hsa-miR-892b	CLIP-seq
MIRT2591523	hsa-miR-124	CLIP-seq
MIRT2591524	hsa-miR-1261	CLIP-seq
MIRT2293466	hsa-miR-1273c	CLIP-seq
MIRT1225133	hsa-miR-193a-3p	CLIP-seq
MIRT1225134	hsa-miR-193b	CLIP-seq
MIRT2065660	hsa-miR-29a	CLIP-seq
MIRT2065661	hsa-miR-29b	CLIP-seq
MIRT2065662	hsa-miR-29c	CLIP-seq
MIRT1225136	hsa-miR-3064-5p	CLIP-seq
MIRT2293469	hsa-miR-3145-5p	CLIP-seq
MIRT1225144	hsa-miR-3652	CLIP-seq
MIRT2293471	hsa-miR-3671	CLIP-seq
MIRT2293472	hsa-miR-3683	CLIP-seq
MIRT2065689	hsa-miR-3714	CLIP-seq
MIRT2591528	hsa-miR-3910	CLIP-seq
MIRT2293475	hsa-miR-4277	CLIP-seq
MIRT2065699	hsa-miR-4426	CLIP-seq
MIRT2065700	hsa-miR-4428	CLIP-seq
MIRT1225156	hsa-miR-4430	CLIP-seq
MIRT1225160	hsa-miR-4505	CLIP-seq
MIRT2591531	hsa-miR-4639-5p	CLIP-seq
MIRT2293477	hsa-miR-4645-3p	CLIP-seq
MIRT2065717	hsa-miR-4647	CLIP-seq
MIRT2065718	hsa-miR-4662b	CLIP-seq
MIRT2065721	hsa-miR-4683	CLIP-seq
MIRT2065722	hsa-miR-4684-5p	CLIP-seq
MIRT2293481	hsa-miR-4762-5p	CLIP-seq
MIRT2065727	hsa-miR-488	CLIP-seq
MIRT2591537	hsa-miR-506	CLIP-seq
MIRT2293484	hsa-miR-508-5p	CLIP-seq
MIRT2591538	hsa-miR-548ad	CLIP-seq
MIRT2065737	hsa-miR-607	CLIP-seq
MIRT1225181	hsa-miR-892b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARNTL	Activation	22750052
CLOCK	Activation	22750052

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	26903630
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IBA
GO:0001222	Function	Transcription corepressor binding	IBA
GO:0005515	Function	Protein binding	IPI	21070773, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26903630
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	26903630
GO:0005737	Component	Cytoplasm	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IBA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IEA
GO:0045187	Process	Regulation of circadian sleep/wake cycle, sleep	IMP	17346965, 19716732, 24439663, 24577121, 26903630
GO:0048511	Process	Rhythmic process	IEA
GO:0050821	Process	Protein stabilization	IMP	26903630

Other IDs

• MIM: 603427
• HGNC: 8847
• e!Ensembl: ENSG00000049246

Protein

• UniProt ID: P56645
• Protein name: Period circadian protein homolog 3 (hPER3) (Cell growth-inhibiting gene 13 protein) (Circadian clock protein PERIOD 3)
• Protein function: Originally described as a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08447	PAS_3	284 → 374	PAS fold	Domain
  PF12114	Period_C	1029 → 1195	Period protein 2/3C-terminal region	Family

• Sequence:

  MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQ
  EMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELAT
  IASEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFY
  AHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHP
  AQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQ
  DLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFV
  NPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVS
  SGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIES
  MTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCI
  DSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMP
  TNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQ
  PAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYF
  QGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHT
  SSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFP
  FPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQ
  RREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNN
  GSESSPATTGALSTGSPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSH
  PTASTLSMGLPPSRTPSHPTATVLSTGSPPSESPSRTGSAASGSSDSSIYLTSSVYSSKI
  SQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESM
  RQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDS
  C

• Sequence length: 1201

Pathways

KEGG:

Circadian rhythm
Circadian entrainment

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADVANCED SLEEP PHASE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Advanced sleep phase syndrome 3	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ADVANCED SLEEP-PHASE SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HOMOCYSTINURIA-MEGALOBLASTIC ANEMIA DUE TO DEFECT IN COBALAMIN METABOLISM, CBLE COMPLEMENTATION TYPE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, SPINE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PER3-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	26637877		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26637877		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25501848, 27771773		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	25501848		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	29846607		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	26406960		★☆☆☆☆ Found in Text Mining only
Advanced Sleep Phase Syndrome	Advanced Sleep Phase Syndrome	BEFREE	16979429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ADVANCED SLEEP PHASE SYNDROME, FAMILIAL, 3	Sleep Phase Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Advanced Sleep-Phase Syndrome, Familial	Advanced Sleep Phase Syndrome	ORPHANET_DG	26903630		★☆☆☆☆ Found in Text Mining only
Advanced Sleep-Phase Syndrome, Familial	Advanced Sleep Phase Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36901420	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	22467995		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28860482, 29614896		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	28860482, 35365695, 38102312	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28860482, 29614896		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	36130474	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	19926609	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	31708917	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	34273025, 34275001, 34275002	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16528748, 18789374, 21316201, 29042894, 30121446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	16528748, 36548883	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21316201, 21835597, 24150227, 24389266, 24673294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	15668506, 15790588, 20625127, 21316201, 23822714, 28177907, 29455641		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20625127		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23822714, 25485508, 25501848, 29958276, 31739444, 39193850, 39201344	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	25485508		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24821610, 29455641		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	11306557, 36901420	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19516903	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22350604		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22350604		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35116071	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23712462, 24037774, 24393525, 27983919		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23712462, 27492458	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24393525, 27983919	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	21102463		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	21102463		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22881285, 26172092, 27153721		★☆☆☆☆ Found in Text Mining only
Delayed Sleep Phase Syndrome	Delayed Sleep Phase Syndrome	BEFREE	11306557, 12841365, 15700718, 16979429, 21919721		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	15869869	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19708722, 26926884, 29614896		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19708722, 19926609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	26926884	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	26926884	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18974966, 21559414, 26440425		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	23323702	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18974966, 21559414, 26440425		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27153721		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	28418034		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26406960		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	26440425		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36748323	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32503923	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial advanced sleep-phase syndrome	Advanced Sleep Phase Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	24135790		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24135790	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24135790		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28177907		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31739444, 36130474	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	37814975	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19516903, 19716732, 22543063, 28900721		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22881285		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37768516	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	37768516	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	24892753		★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	28418034		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26637877		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18444243		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22689435, 22809120, 25344870, 25591621		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25550826	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35575281	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28177907		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28177907		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16528748		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16528748		★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	16528748	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16528748		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16528748		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26926884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15668506, 15790588, 20625127, 21316201, 23822714, 28177907, 29455641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20625127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24821610, 29455641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25798752, 28177907		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19934327, 29771413		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19926609, 21380491, 24866331, 25837749, 28177907, 30008892, 31609143		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22350604		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20625127		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20625127		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20625127		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	19708722		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37373286	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19708722, 26926884, 29614896		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19708722, 19926609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	29248294		★☆☆☆☆ Found in Text Mining only
Mental Retardation Autosomal Dominant 1	Intellectual developmental disorder	Pubtator	25271084	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28296937, 36497566	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	16528748, 28860482	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17512705, 19708722, 27102916, 27996307, 28860482, 30121446		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	38642856	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29055480		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35008743	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16999817		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	16999817		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	16999817		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24866331		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20625127, 22080729, 22081375, 22350604, 22689435, 24393525, 25485508, 28177907		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24907400		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24821610, 28177907		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20205566		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20625127		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30575220	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25798752, 28177907		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28614626		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26637877		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19934327, 29771413		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19934327, 29771413, 34604590, 35154101	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	22350604		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25535886		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20364331		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	17969870, 28860482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	17969870, 21835597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal affective disorder	Pubtator	28860482	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	37814975	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	30657733		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	30657733	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	18714788, 18835917, 19360490, 19516903, 23029352, 23440187, 33920292	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	18958851, 25201053, 25501848, 26440425, 27102916, 28276850, 29055480		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	11306557, 12841365, 15961535, 16528748, 17309758, 20469812, 25201053	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Wake Disorders	Sleep Wake Disorders	BEFREE	28276850		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22081375, 36505439, 37968308	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37342762	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22081375		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24708606	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34162762	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39193850	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22881285, 26172092		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	26926884		★☆☆☆☆ Found in Text Mining only