APLN (apelin)

Gene

• Entrez ID: 8862
• Gene name: Apelin
• Gene symbol: APLN
• Synonyms (NCBI Gene): APEL, XNPEP2
• Chromosome: X
• Chromosome location: Xq26.1
• Summary: This gene encodes a peptide that functions as an endogenous ligand for the G-protein coupled apelin receptor. The encoded preproprotein is proteolytically processed into biologically active C-terminal peptide fragments. These peptide fragments activate di

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047924	hsa-miR-30c-5p	CLASH	23622248
MIRT046134	hsa-miR-30b-5p	CLASH	23622248
MIRT573091	hsa-miR-6729-3p	PAR-CLIP	20371350
MIRT573092	hsa-miR-4286	PAR-CLIP	20371350
MIRT573090	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT573089	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT573088	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT573086	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT573087	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT573085	hsa-miR-4713-5p	PAR-CLIP	20371350
MIRT573084	hsa-miR-6867-3p	PAR-CLIP	20371350
MIRT573083	hsa-miR-629-3p	PAR-CLIP	20371350
MIRT731163	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Microarray, Western blot	25532941
MIRT731163	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Microarray, Western blot	25532941
MIRT732457	hsa-miR-193b-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	32803505
MIRT733005	hsa-miR-124-3p	Luciferase reporter assay	32692577
MIRT734275	hsa-miR-424-5p	ELISA, Western blotting, Luciferase reporter assay, qRT-PCR	32774725
MIRT734275	hsa-miR-424-5p	ELISA, Western blotting, Luciferase reporter assay, qRT-PCR	32774725
MIRT734777	hsa-miR-182-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32099369
MIRT573091	hsa-miR-6729-3p	PAR-CLIP	20371350
MIRT573092	hsa-miR-4286	PAR-CLIP	20371350
MIRT573090	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT573089	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT573088	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT573086	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT573087	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT573085	hsa-miR-4713-5p	PAR-CLIP	20371350
MIRT573084	hsa-miR-6867-3p	PAR-CLIP	20371350
MIRT573083	hsa-miR-629-3p	PAR-CLIP	20371350
MIRT789551	hsa-miR-103a	CLIP-seq
MIRT789552	hsa-miR-107	CLIP-seq
MIRT789553	hsa-miR-1207-3p	CLIP-seq
MIRT789554	hsa-miR-15a	CLIP-seq
MIRT789555	hsa-miR-15b	CLIP-seq
MIRT789556	hsa-miR-16	CLIP-seq
MIRT789557	hsa-miR-195	CLIP-seq
MIRT789558	hsa-miR-296-5p	CLIP-seq
MIRT789559	hsa-miR-3115	CLIP-seq
MIRT789560	hsa-miR-3155	CLIP-seq
MIRT789561	hsa-miR-3155b	CLIP-seq
MIRT789562	hsa-miR-3183	CLIP-seq
MIRT789563	hsa-miR-3675-5p	CLIP-seq
MIRT789564	hsa-miR-424	CLIP-seq
MIRT789565	hsa-miR-4435	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT789567	hsa-miR-4503	CLIP-seq
MIRT789568	hsa-miR-4524	CLIP-seq
MIRT789569	hsa-miR-4684-5p	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT789571	hsa-miR-4723-3p	CLIP-seq
MIRT789572	hsa-miR-4749-3p	CLIP-seq
MIRT789573	hsa-miR-484	CLIP-seq
MIRT789574	hsa-miR-486-3p	CLIP-seq
MIRT789575	hsa-miR-497	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT789577	hsa-miR-646	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT789574	hsa-miR-486-3p	CLIP-seq
MIRT1555963	hsa-miR-125a-5p	CLIP-seq
MIRT1555964	hsa-miR-125b	CLIP-seq
MIRT1555965	hsa-miR-3136-3p	CLIP-seq
MIRT1555966	hsa-miR-3153	CLIP-seq
MIRT1555967	hsa-miR-4319	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT1555968	hsa-miR-4493	CLIP-seq
MIRT1555969	hsa-miR-4697-3p	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT1555970	hsa-miR-4732-3p	CLIP-seq
MIRT1555971	hsa-miR-670	CLIP-seq
MIRT1932910	hsa-miR-1237	CLIP-seq
MIRT1932911	hsa-miR-1248	CLIP-seq
MIRT1932912	hsa-miR-1287	CLIP-seq
MIRT1932913	hsa-miR-137	CLIP-seq
MIRT1932914	hsa-miR-1587	CLIP-seq
MIRT789554	hsa-miR-15a	CLIP-seq
MIRT789555	hsa-miR-15b	CLIP-seq
MIRT789556	hsa-miR-16	CLIP-seq
MIRT789557	hsa-miR-195	CLIP-seq
MIRT789558	hsa-miR-296-5p	CLIP-seq
MIRT789562	hsa-miR-3183	CLIP-seq
MIRT1932915	hsa-miR-3667-3p	CLIP-seq
MIRT1932916	hsa-miR-3921	CLIP-seq
MIRT789564	hsa-miR-424	CLIP-seq
MIRT1932917	hsa-miR-4303	CLIP-seq
MIRT1932918	hsa-miR-4468	CLIP-seq
MIRT1932919	hsa-miR-4492	CLIP-seq
MIRT1932920	hsa-miR-4498	CLIP-seq
MIRT789567	hsa-miR-4503	CLIP-seq
MIRT1932921	hsa-miR-4522	CLIP-seq
MIRT1932922	hsa-miR-4653-5p	CLIP-seq
MIRT789569	hsa-miR-4684-5p	CLIP-seq
MIRT1932923	hsa-miR-4714-5p	CLIP-seq
MIRT789571	hsa-miR-4723-3p	CLIP-seq
MIRT789572	hsa-miR-4749-3p	CLIP-seq
MIRT1932924	hsa-miR-4803	CLIP-seq
MIRT1932925	hsa-miR-483-3p	CLIP-seq
MIRT789575	hsa-miR-497	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT1932926	hsa-miR-570	CLIP-seq
MIRT1932927	hsa-miR-628-5p	CLIP-seq
MIRT1932928	hsa-miR-668	CLIP-seq
MIRT1932929	hsa-miR-762	CLIP-seq
MIRT789551	hsa-miR-103a	CLIP-seq
MIRT789552	hsa-miR-107	CLIP-seq
MIRT2173058	hsa-miR-1252	CLIP-seq
MIRT2173059	hsa-miR-1321	CLIP-seq
MIRT2173060	hsa-miR-1910	CLIP-seq
MIRT2173061	hsa-miR-3166	CLIP-seq
MIRT2173062	hsa-miR-3184	CLIP-seq
MIRT2173063	hsa-miR-3915	CLIP-seq
MIRT2173064	hsa-miR-3928	CLIP-seq
MIRT2173065	hsa-miR-423-5p	CLIP-seq
MIRT2173066	hsa-miR-4270	CLIP-seq
MIRT2173067	hsa-miR-4436b-3p	CLIP-seq
MIRT2173068	hsa-miR-4441	CLIP-seq
MIRT2173069	hsa-miR-4476	CLIP-seq
MIRT789566	hsa-miR-4488	CLIP-seq
MIRT2173070	hsa-miR-4533	CLIP-seq
MIRT2173071	hsa-miR-455-3p	CLIP-seq
MIRT2173072	hsa-miR-4640-5p	CLIP-seq
MIRT2173073	hsa-miR-4685-5p	CLIP-seq
MIRT789570	hsa-miR-4697-5p	CLIP-seq
MIRT2173074	hsa-miR-4726-5p	CLIP-seq
MIRT2173075	hsa-miR-4728-5p	CLIP-seq
MIRT2173076	hsa-miR-4739	CLIP-seq
MIRT2173077	hsa-miR-4756-5p	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT789554	hsa-miR-15a	CLIP-seq
MIRT789555	hsa-miR-15b	CLIP-seq
MIRT789556	hsa-miR-16	CLIP-seq
MIRT789557	hsa-miR-195	CLIP-seq
MIRT789564	hsa-miR-424	CLIP-seq
MIRT789567	hsa-miR-4503	CLIP-seq
MIRT789575	hsa-miR-497	CLIP-seq
MIRT789576	hsa-miR-503	CLIP-seq
MIRT2443790	hsa-miR-138	CLIP-seq
MIRT1555965	hsa-miR-3136-3p	CLIP-seq
MIRT2443791	hsa-miR-3180	CLIP-seq
MIRT2443792	hsa-miR-3180-3p	CLIP-seq
MIRT2443793	hsa-miR-3196	CLIP-seq
MIRT2443794	hsa-miR-3646	CLIP-seq
MIRT2443795	hsa-miR-3652	CLIP-seq
MIRT2443796	hsa-miR-4260	CLIP-seq
MIRT2443797	hsa-miR-4299	CLIP-seq
MIRT2443798	hsa-miR-4308	CLIP-seq
MIRT2443799	hsa-miR-4430	CLIP-seq
MIRT2443800	hsa-miR-4464	CLIP-seq
MIRT2443801	hsa-miR-4505	CLIP-seq
MIRT2443802	hsa-miR-4748	CLIP-seq
MIRT789572	hsa-miR-4749-3p	CLIP-seq
MIRT2443803	hsa-miR-493	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10644702
GO:0002031	Process	G protein-coupled receptor internalization	IMP	12582207
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9792798
GO:0005179	Function	Hormone activity	IDA	22810587, 38428423
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	IMP	28137936
GO:0005576	Component	Extracellular region	IDA	28137936
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	22810587, 38428423
GO:0005615	Component	Extracellular space	IDA	22810587, 38428423
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9792798
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	38428423
GO:0007369	Process	Gastrulation	IEA
GO:0007595	Process	Lactation	TAS
GO:0007631	Process	Feeding behavior	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IC	10644702, 12582207
GO:0010629	Process	Negative regulation of gene expression	IGI	23263626
GO:0031652	Process	Positive regulation of heat generation	IEA
GO:0031704	Function	Apelin receptor binding	IDA	28137936
GO:0031704	Function	Apelin receptor binding	IEA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IGI	23263626
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0042756	Process	Drinking behavior	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0045823	Process	Positive regulation of heart contraction	IEA
GO:0045823	Process	Positive regulation of heart contraction	ISS
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050878	Process	Regulation of body fluid levels	IEA
GO:0051461	Process	Positive regulation of corticotropin secretion	IEA
GO:0051466	Process	Positive regulation of corticotropin-releasing hormone secretion	IEA
GO:0060183	Process	Apelin receptor signaling pathway	IDA	22810587
GO:0060183	Process	Apelin receptor signaling pathway	IDA	11359874, 22810587, 38428423
GO:0060183	Process	Apelin receptor signaling pathway	IEA
GO:0060183	Process	Apelin receptor signaling pathway	IMP	38428423
GO:0060183	Process	Apelin receptor signaling pathway	IMP	28137936
GO:0060976	Process	Coronary vasculature development	IEA
GO:0060976	Process	Coronary vasculature development	ISS
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	23263626
GO:1903243	Process	Negative regulation of cardiac muscle hypertrophy in response to stress	ISS	22810587
GO:1903244	Process	Positive regulation of cardiac muscle hypertrophy in response to stress	ISS
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IDA	11359874
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	23263626
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IDA	23263626

Other IDs

• MIM: 300297
• HGNC: 16665
• e!Ensembl: ENSG00000171388

Protein

• UniProt ID: Q9ULZ1
• Protein name: Apelin (APJ endogenous ligand) [Cleaved into: Apelin-36; Apelin-31; Apelin-28; Apelin-13]
• Protein function: Peptide hormone that functions as endogenous ligand for the G-protein-coupled apelin receptor (APLNR/APJ), that plays a role in cadiovascular homeostasis (PubMed:10525157, PubMed:22810587, PubMed:35817871, PubMed:38428423). Functions as a balanc
• PDB: 8XQE, 8XQF, 8XZG, 8XZH, 8XZJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15360	Apelin	23 → 77	APJ endogenous ligand	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain (PubMed:10617103). Secreted by the mammary gland into the colostrum and the milk. {ECO:0000269|PubMed:10617103}.
• Sequence:

  MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
  KFRRQRPRLSHKGPMPF

• Sequence length: 77

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Apelin signaling pathway

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	27543713, 31429306		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24316062		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31547096		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31070305		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31816601	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25486928	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	25486928		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	19015606	Inhibit	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	33881940	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28065733, 29680708, 31199948, 31513835		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28065733, 29680708, 31199948, 31513835		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31189595		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	29844647		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	27585243		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	28957639		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	29721104	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	25486928	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26494002, 27825851, 28444107, 28653788, 29336478, 29691838		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22927708	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	28962638		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20649580, 23438363	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26494002, 27825851, 28444107, 28653788, 29336478, 29691838		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29721104, 30278567, 30518720		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29721104	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	30518720	Inhibit	★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30485657		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30984306		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30876980		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17412318		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	17412318		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26135903, 31267692, 31318171		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33972642	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36087034, 39227683, 40304310	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31264472		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24966992, 34636395, 35429302, 38114725, 39227683	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30984306		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31070305, 31318171		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30783205, 32481352	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26135903		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	28854362		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28728608	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29749463, 30286717		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12914775, 17826642		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19443838, 19754391, 24990699, 26102594, 27543713, 27825851, 28017911, 28293165, 29205940, 29245958, 29423718, 29684595, 29844647, 29875677, 29916125, 30387843, 30459635, 30634441, 31101543, 31166051, 31299236		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20649580, 35748053	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28944878	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28402976, 29916125		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	35748053	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	36614283	Associate	★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	29309764		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	25164121, 28847490, 31337837		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28123583, 30783205		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29329678, 31040784		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17391779, 29309764		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28487489, 29254197, 31547096		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28487489	Associate	★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	27686494		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27894959		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	25184296		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	29632960		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	18390990	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12914775, 17826642, 17906101, 23817469, 25184296, 25993436, 27815337, 27889567, 29632960, 29773582, 29775410, 29807055, 29844647, 30627376, 30659278, 30901161, 31101543, 31316680, 31645268, 31724863		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28123583, 30783205, 31236331		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12914775, 25592107, 27854125, 28915675, 31429306		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12914775, 23226564, 25592107, 28915675, 28957639		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	19100414		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20649580	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23226564, 25592107, 28902642	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25729940	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36980823	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12914775, 25592107, 28915675, 29632960		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	19015606	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	28902642	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29309764		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20652246, 20664951, 23318714, 28812414		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29432881, 30142367, 31445676		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27650065, 29412822, 29626513, 30157220, 31829402		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32208782	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18484561		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24362107	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26295182	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27650065, 27831922, 29412822, 29626513, 30157220, 31829402		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23429279, 26295182, 26316706, 36481653	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26904686		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19567136, 20233941, 22445464, 23429279, 23577111, 26789934, 27831922, 28125271, 28164323, 28837139, 29101069, 29229313, 29626513, 30334404, 30387843, 30526660, 30583036, 30954534, 31548844, 31829402		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	20055692		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23577111, 28837139, 29522374, 30301930		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27650065, 31686535		★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	31199948		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30954534		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	20220056, 25324682		★☆☆☆☆ Found in Text Mining only
Esophageal and Gastric Varices	Esophageal and gastric varices	Pubtator	35895373	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33794814, 35920446, 36588538	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30640413	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19307984, 20485192, 26125862, 27450650, 27543713		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29577579		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31270645, 31653030		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28087150		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	34156425	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29053791, 30718358, 31043429		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31043429	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36193059	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29053791, 30718358, 31043429		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17412318		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36193059	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	31382403	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20649580, 25729940, 29721104, 31382403, 36239923	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28974565, 29875677, 30278567		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12914775, 17826642, 17906101, 23817469, 25184296, 25993436, 27815337, 27889567, 29632960, 29773582, 29775410, 29807055, 29844647, 30627376, 30659278, 30901161, 31101543, 31316680, 31645268, 31724863		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	12914775		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	16464638	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20649580, 25184296, 25993436	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Valve Diseases	Heart valve disease	Pubtator	30518720	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	35501731	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	24966992	Associate	★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	25918383		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29901077		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	26295182	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	15677759, 16733497, 20233941, 30526660, 30954534, 31686535		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23226564, 25143330, 25272042, 25539544, 27338090, 36481653	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25272042, 25729940	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	30217946	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	28275232, 28945940, 28987634		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19307984, 19443838, 20485192, 21233449, 22109355, 23226564, 24990699, 25143330, 25272042, 27338090, 27450650, 27599667, 27863393, 27903222, 28255983, 28534648, 28945940, 28987634, 29395316, 29652188, 29800734, 30459635, 30525273, 30582943, 30627376, 30659278, 30755060, 31657686		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31019180		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31019180		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	30710622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	CTD_human_DG	30710622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	21448846, 24247107	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22895257, 32692577	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23263626, 28137936, 29807055, 30087215, 30710493, 30901161		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29329678, 31040784		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17391779		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21775567, 26295182, 34660801, 36481653	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30731113		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17391779, 31306342		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28167898, 29085332, 29278852, 29916125, 30709405		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	24469934		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	20055692		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25275024, 30061611, 31410213		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18816630		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35895373	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35895373	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30061611		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29947284		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24374773, 36087034	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24962866		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30640413	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17412318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26135903, 31267692, 31318171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31070305, 31318171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26135903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25532941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27733135		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30984306		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20581707, 24316062, 24469934, 26135903, 27733135, 28111160, 29875677, 30127323, 30755060		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28051763, 29465158		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	28381873		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29432881, 30142367, 31445676		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23429279, 23437347, 26565000, 28164323, 28620355, 30570369		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	23429279, 24362107	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29482601, 30597883, 30696454, 31217908		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28065733		★☆☆☆☆ Found in Text Mining only
Motor Disorders	Motor Disorders	BEFREE	31121196		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28710384		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28710384		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31129285		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23817469, 28614788, 29245958, 29249393, 30627376		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	25993436	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27854125, 29249393, 31429306		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	27571457		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17563744, 20581707, 22037214, 24962866, 25275024, 26135903, 27733135, 29053791, 29750964, 30640413, 31264472, 31267692		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29901077		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31121196, 31254280, 31385138		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28616057, 31270645		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20581707		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28782414		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15677759, 16723381, 16733497, 20233941, 21609753, 21775567, 23378608, 23429279, 23943882, 27494693, 28125271, 28616057, 29101069, 29229313, 29412822, 29652188, 30334404, 30696454, 30835509, 31264472, 31472173		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18390990, 26295182, 36481653	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21775567, 23429279, 23438363, 24362107, 30835509, 32998691, 33972642, 34371941, 34660801, 36189989, 37901192	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28013452		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20652246, 32131466, 35069930	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	29945585	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29945585		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29857005		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26135903		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	27846147		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28782414, 29901077, 30736903, 30905782, 30914252, 31254280, 31306618, 31586624		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	39273568	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	29329678, 31121196		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	25324682		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	31525345		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21575945	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29498342, 31382403, 31814467		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31382403, 31814467	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35701786, 36695944	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31513835		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	20220056, 25324682		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25532941		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	36591713	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36591713	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	26295182	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29747483		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23263626, 29807055, 30710493, 30901161		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	30087215	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	25918383	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	25918383, 32692577	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30783205, 31236331		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28847490		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	27193873		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31686535		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	23296045, 29091306		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28017911, 29423718, 30917508		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	33743591	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28777197, 29749463, 30061611		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	21448846		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31383242		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	31383242		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30640413		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27770057, 27889567, 28728608, 29150476, 30614822		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28821440, 29577579		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27733135		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27733135, 36974534	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30036660, 30935689, 31791369		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29676521		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25298206	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	30518720	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17391779		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30984306	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33881940, 38561035	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	35895373	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	21437254	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22895257, 22927708	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27193873, 31189595, 31738185		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	25272042	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31533725	Stimulate	★☆☆☆☆ Found in Text Mining only