CCKAR (cholecystokinin A receptor)

Gene

• Entrez ID: 886
• Gene name: Cholecystokinin A receptor
• Gene symbol: CCKAR
• Synonyms (NCBI Gene): CCK-1R, CCK-A, CCK1-R, CCK1R, CCKRA
• Chromosome: 4
• Chromosome location: 4p15.2
• Summary: This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallb

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT870838	hsa-miR-1200	CLIP-seq
MIRT870839	hsa-miR-1236	CLIP-seq
MIRT870840	hsa-miR-1468	CLIP-seq
MIRT870841	hsa-miR-4695-3p	CLIP-seq
MIRT870842	hsa-miR-4734	CLIP-seq
MIRT870843	hsa-miR-4746-3p	CLIP-seq
MIRT870844	hsa-miR-4778-3p	CLIP-seq
MIRT870839	hsa-miR-1236	CLIP-seq
MIRT1958588	hsa-miR-1237	CLIP-seq
MIRT1958589	hsa-miR-1248	CLIP-seq
MIRT1958590	hsa-miR-136	CLIP-seq
MIRT1958591	hsa-miR-3194-3p	CLIP-seq
MIRT1958592	hsa-miR-4268	CLIP-seq
MIRT1958593	hsa-miR-4448	CLIP-seq
MIRT1958594	hsa-miR-4753-3p	CLIP-seq
MIRT1958595	hsa-miR-767-3p	CLIP-seq
MIRT1958596	hsa-miR-942	CLIP-seq
MIRT2446452	hsa-miR-2681	CLIP-seq
MIRT2446453	hsa-miR-4286	CLIP-seq
MIRT2446454	hsa-miR-4519	CLIP-seq
MIRT2446455	hsa-miR-4758-3p	CLIP-seq
MIRT2446452	hsa-miR-2681	CLIP-seq
MIRT2446453	hsa-miR-4286	CLIP-seq
MIRT2446454	hsa-miR-4519	CLIP-seq
MIRT2446455	hsa-miR-4758-3p	CLIP-seq
MIRT2446452	hsa-miR-2681	CLIP-seq
MIRT2446453	hsa-miR-4286	CLIP-seq
MIRT2446454	hsa-miR-4519	CLIP-seq
MIRT2446455	hsa-miR-4758-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004951	Function	Cholecystokinin receptor activity	IBA
GO:0004951	Function	Cholecystokinin receptor activity	IDA	8503909
GO:0004951	Function	Cholecystokinin receptor activity	IEA
GO:0004951	Function	Cholecystokinin receptor activity	TAS	8343165
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8343165
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8343165
GO:0007409	Process	Axonogenesis	IEA
GO:0016020	Component	Membrane	IDA	8503909
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IPI	8503909
GO:0030900	Process	Forebrain development	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0038188	Process	Cholecystokinin signaling pathway	IDA	8503909
GO:0046883	Process	Regulation of hormone secretion	IBA

Other IDs

• MIM: 118444
• HGNC: 1570
• e!Ensembl: ENSG00000163394

Protein

• UniProt ID: P32238
• Protein name: Cholecystokinin receptor type A (CCK-A receptor) (CCK-AR) (Cholecystokinin-1 receptor) (CCK1-R)
• Protein function: Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced
• PDB: 1D6G, 1HZN, 7EZH, 7EZK, 7EZM, 7F8U, 7F8X, 7F8Y, 7MBX, 7MBY, 7XOU, 7XOV, 9BKJ, 9BKK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09193	CholecysA-Rec_N	1 → 47	Cholecystokinin A receptor, N-terminal	Domain
  PF00001	7tm_1	58 → 370	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
  LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
  MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
  NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
  KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
  SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
  TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
  MSASVPPQ

• Sequence length: 428

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Insulin secretion
Pancreatic secretion

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLECYSTOKININ A RECEPTOR POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY ALDOSTERONISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	10457335, 10749330		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24381135	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29433086		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31388831		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	21978736		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	21978736		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	23701593		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	23701593	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21978736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21978736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	26508021	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	12572876, 15908333		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	12572876, 15908333, 27287528		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	28592602	Associate	★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	28592602, 28625150		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37107586	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28288880		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26508021	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11773861, 9192855		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11773861, 15908333, 9192855		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31691451	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	9192855		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	16362631		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25025063		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	CTD_human_DG	25025063		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23701593, 25025063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	36871090	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	27287528		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	12777967, 15313848		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	15927089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	15927089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	23701593, 25025063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	CTD_human_DG	25025063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10457335, 26820391, 27072272		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27072272, 8844981		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25025063		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28288880		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15980969		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26608796		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28343167		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	9920090		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11773861, 14740316, 16362631, 19295535, 30591538, 30624060, 9192855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	14740316	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10457335, 27072272		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15682471, 27072272, 9239407	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	12627462, 15108185, 20023595		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	15108185		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	22825913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	PSYGENET_DG	22825913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	12777967, 15313848		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	12777967		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30840133		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	17413443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	10572328, 10893485, 11549403, 15363473, 17413443, 17413452, 19753663, 22825913, 28343167		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15363473, 17413443		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15363473, 17413443, 17413452, 19753663, 22825913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27072272		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27072272	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	15927089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations