NR1I2 (nuclear receptor subfamily 1 group I member 2)

Gene

• Entrez ID: 8856
• Gene name: Nuclear receptor subfamily 1 group I member 2
• Gene symbol: NR1I2
• Synonyms (NCBI Gene): BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
• Chromosome: 3
• Chromosome location: 3q13.33
• Summary: This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002079	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT002079	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT003998	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	18268015
MIRT051226	hsa-miR-16-5p	CLASH	23622248
MIRT040092	hsa-miR-615-3p	CLASH	23622248
MIRT731924	hsa-miR-30c-1-3p	Luciferase reporter assay	27085140
MIRT731924	hsa-miR-30c-1-3p	Luciferase reporter assay	27085140
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, Western blot	28408657
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31998607
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31998607
MIRT003998	hsa-miR-148a-3p	Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	35276090
MIRT1192158	hsa-miR-2467-3p	CLIP-seq
MIRT1192159	hsa-miR-3664-3p	CLIP-seq
MIRT1192160	hsa-miR-3678-3p	CLIP-seq
MIRT1192161	hsa-miR-3908	CLIP-seq
MIRT1192162	hsa-miR-4432	CLIP-seq
MIRT1192163	hsa-miR-4743	CLIP-seq
MIRT1192164	hsa-miR-510	CLIP-seq
MIRT1192165	hsa-miR-548u	CLIP-seq
MIRT1192166	hsa-miR-663b	CLIP-seq
MIRT1192167	hsa-miR-873	CLIP-seq
MIRT1192168	hsa-miR-3545-3p	CLIP-seq
MIRT1192169	hsa-miR-4447	CLIP-seq
MIRT1192170	hsa-miR-4472	CLIP-seq
MIRT1192171	hsa-miR-4481	CLIP-seq
MIRT1192172	hsa-miR-4494	CLIP-seq
MIRT1192173	hsa-miR-4499	CLIP-seq
MIRT1192174	hsa-miR-4539	CLIP-seq
MIRT1192175	hsa-miR-4651	CLIP-seq
MIRT1192176	hsa-miR-4700-3p	CLIP-seq
MIRT1192177	hsa-miR-4724-5p	CLIP-seq
MIRT1192178	hsa-miR-4745-5p	CLIP-seq
MIRT1192179	hsa-miR-4747-5p	CLIP-seq
MIRT1192180	hsa-miR-4759	CLIP-seq
MIRT1192181	hsa-miR-4795-5p	CLIP-seq
MIRT1192182	hsa-miR-608	CLIP-seq
MIRT1192183	hsa-miR-637	CLIP-seq
MIRT2455369	hsa-miR-1179	CLIP-seq
MIRT2455370	hsa-miR-1912	CLIP-seq
MIRT2455371	hsa-miR-3130-5p	CLIP-seq
MIRT2455372	hsa-miR-338-3p	CLIP-seq
MIRT2455373	hsa-miR-4310	CLIP-seq
MIRT2455374	hsa-miR-4323	CLIP-seq
MIRT2455375	hsa-miR-4482	CLIP-seq
MIRT1192167	hsa-miR-873	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DR1	Activation	18305375
HNF4A	Activation	12601364;18305375
NCOR2	Unknown	16219912
NR1H4	Activation	21476904
NR3C1	Unknown	12815172
PROX1	Repression	22023334

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11114890
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11114890
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	12578355
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	12578355, 20413580, 22939624, 23602807
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IPI	12909012, 23602807
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	9727070
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	12578355
GO:0007165	Process	Signal transduction	TAS	9784494
GO:0008202	Process	Steroid metabolic process	TAS	9784494
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016922	Function	Nuclear receptor binding	IDA	9727070
GO:0030154	Process	Cell differentiation	IBA
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0042178	Process	Xenobiotic catabolic process	IDA	12578355
GO:0042908	Process	Xenobiotic transport	IDA	12578355
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11891224
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12578355
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11114890
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	12909012, 23602807
GO:0046872	Function	Metal ion binding	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	ISS
GO:0071219	Process	Cellular response to molecule of bacterial origin	IEA
GO:0071219	Process	Cellular response to molecule of bacterial origin	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 603065
• HGNC: 7968
• e!Ensembl: ENSG00000144852

Protein

• UniProt ID: O75469
• Protein name: Nuclear receptor subfamily 1 group I member 2 (Orphan nuclear receptor PAR1) (Orphan nuclear receptor PXR) (Pregnane X receptor) (Steroid and xenobiotic receptor) (SXR)
• Protein function: Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics,
• PDB: 1ILG, 1ILH, 1M13, 1NRL, 1SKX, 2O9I, 2QNV, 3CTB, 3HVL, 3R8D, 4J5W, 4J5X, 4NY9, 4S0S, 4S0T, 4X1F, 4X1G, 4XAO, 4XHD, 5A86, 5X0R, 6BNS, 6DUP, 6HJ2, 6HTY, 6NX1, 6P2B, 6S41, 6TFI, 6XP9, 7AX8, 7AX9, 7AXA, 7AXB, 7AXC, 7AXD, 7AXE, 7AXF, 7AXG, 7AXH, 7AXI, 7AXJ, 7AXK, 7AXL, 7N2A, 7RIO, 7RIU, 7RIV, 7YFK, 8CCT, 8CF9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00105	zf-C4	39 → 109	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	238 → 415	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in liver, colon and small intestine.
• Sequence:

  MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
  CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
  RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
  GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
  PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
  CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
  VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
  ATPLMQELFGITGS

• Sequence length: 434

Pathways

Reactome:

Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT ESOPHAGUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	25880702		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30646906		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14583448, 18757438, 28173772, 28187035, 30196987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	17003290, 22363234		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12548614		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11964083, 18366077, 31048498		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	LHGDN	15985196		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	17727088, 27423452		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29182653		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28267691		★☆☆☆☆ Found in Text Mining only
AMYOTROPHY, HEREDITARY NEURALGIC	Hereditary Neuralgic Amyotrophy	BEFREE	29425889		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27248167		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	18802482		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28088683		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28088683		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	16763722		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	30963258, 31843813		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16893397, 18633604, 21685500, 24755147, 28220880, 28959204, 29425287, 29599135, 30511258, 31748641		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17195212, 17328048, 17347265, 19247167, 24385683		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10641562, 12589358, 18077203, 26658828, 27423452, 28317204, 31168305, 31430011		★☆☆☆☆ Found in Text Mining only
Asthma, Aspirin-Induced	Asthma	BEFREE	14586772		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16893397, 18633604, 21685500, 24755147, 28220880, 28959204, 29425287, 29599135, 30511258, 31748641		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28747025, 29378352, 29801760, 30017860		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28222093		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	26089202		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11287624, 26079624		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	30925093		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	CTD_human_DG	21977915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	21977915	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	28187035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16245281, 18386288		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	20740367		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28676933		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	16091733		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	23832758		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28199000	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11964083, 12637343, 16397244, 16397270, 16925462, 17761971, 18056193, 18372913, 18757438, 18981011, 19010908, 19011999, 19123943, 19538737, 19746521, 20635135, 20846001, 21318602, 21799402, 21822552, 22593082, 22750628, 23287882, 24009311, 24177339, 24398324, 25386994, 26513020, 26600192, 27094683, 28622580, 30008831, 30172372, 30515835, 30822721, 31739702		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18565212, 18981011, 19010908, 19123943, 19746521, 27644647	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	22770587		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	19386802		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21342487	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12645337		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21127053, 21764778, 22023334, 22447115, 25024626, 26232425, 31739702, 32106230, 33941198, 34257549, 36091935, 36707511, 38052560	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20840328, 28676933		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21703428, 21882348, 24138209, 25268617, 31572459, 31759826		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15455382, 18765524, 21093894, 28148395, 29848718		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23519392, 24755147, 25811240, 29425287		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	23303387, 31611795		★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	20930120		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	22986532	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28443061, 29343482, 30718498		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18937843, 30093972, 30700181		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30093972, 30700181		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28202519		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12645337, 20740367, 26045277		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	26504856	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	15331348, 16455805	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	15684063, 19958310, 21359593, 22982774, 25660334, 28575098, 29145837, 29204052, 29718219, 31336134		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	18800312, 19958310, 24498169, 28575098		★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	11607932, 24954360		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28025140		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12589358, 18077203, 24973402, 26535635		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	20530726, 21954916, 26564991, 28146220		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30973971		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	30973971		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31697926		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17347265		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17170021, 20627999, 21599020, 28237809, 29891588, 29945292, 30237580, 31614203, 31719637		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21245992, 33686088	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12707033, 18096695, 20041327, 20196838, 20531417, 21733184, 22815676, 23170789, 23233043, 27279570		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12707033, 17404718, 20531417		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20196838	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20196838, 20836841, 21490239, 23170789, 26074693, 26547791, 28356150, 29333614, 29548788, 30384048, 30841957		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20041327, 20196838, 20836841, 21342487, 21733184	Associate	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	22978668		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29019057, 30278198		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24312345		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23517743, 30511089		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16194864		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10972534, 16194864		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16194864, 28086762		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17581194		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15236169, 16472590, 17828778, 18381611, 19516190, 20627999, 21830270, 28296821, 28742404, 31581194		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16472590		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19664207, 32024859, 32678214	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27013401	Inhibit	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	22581587		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11804840, 31251978		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17328048, 18031579, 19264156, 21682866, 21905006, 22294633		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	20627999		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15905579		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29273149, 29458120, 30287285		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	29273149	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12483038, 28238749, 28614190, 28927887, 29273149, 29458120, 30287285, 30471839, 31292344, 31487753		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	24315978, 29458120		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24721462, 26564991, 27041449, 28534176, 29212764, 29886826, 30183039, 30726709, 31005591, 31217373, 31371788, 31759113		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	20869355		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24721462, 26564991, 27041449, 28534176, 29212764, 29886826, 30183039, 30726709, 30767625, 31005591, 31217373, 31371788, 31759113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	26855179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	28436464	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28722480, 29118913, 31833801		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24362030, 26564991, 29232162, 30594432, 31287960		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	23116220		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27283743, 29118913, 29212764, 31287960, 31666446		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	16597678, 21057178, 22071895, 22791839, 25056248, 9140395, 9254856		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	30925093		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	23519392, 30728326		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12483038, 28238749, 28614190, 28927887, 29273149, 29458120, 30287285, 30471839, 31292344, 31487753		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	28335376	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12970323, 16875721		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12760308		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22672593, 29335207		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29348584		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex Superficialis	Epidermolysis Bullosa	BEFREE	28450279		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21316268, 24384557, 28303499, 31793425		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	21316268	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21093894, 28148395, 29848718		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27906434, 29977156		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21977915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27906434		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36475339	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19860844	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28030800		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	22790967, 25182422, 30677459		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	24300333	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	25182422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	29738703, 30726709		★☆☆☆☆ Found in Text Mining only
Fibroatheroma	Fibroatheroma	CTD_human_DG	29425287		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18005014, 18194834, 28534176, 28883694		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	21977915	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	20588261, 27512850		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	17262809		★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	22815676		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	22993310		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	28335376	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	19969492		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28670703		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22682129, 24790104, 26526635, 26616854, 28059652, 28256372, 30619047		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26526635	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20462964, 22682129, 24790104, 26526635, 26616854, 28059652, 28256372, 30619047		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26526635	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26616854, 30619047		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28245472		★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	17137471, 25806575		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17828778		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24312345		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28094938		★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	15671183		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	39322061	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28155585, 30955248		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	24721462, 25811240, 30677459		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	25811240, 29431616		★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	27706725	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22461388, 30925093, 31217373		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	22503787		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	27377607		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19060230, 19652365, 20971733, 23919450		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	22461388		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	21599020, 24368568		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	16951492		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11804840, 15236169, 16472590, 17170021, 17828778, 18624678, 19516190, 20627999, 20848487, 21245992, 21830270, 22790967, 23413096, 24886881, 25472953, 26674743, 26906544, 27894906, 28288941, 28742404, 29945292, 30423580, 30804707, 31139192, 31581194, 31614203, 31719637		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21245992, 26855179, 31581194	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27013401, 32024859	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29458120		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31196050		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31697926		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	20198321		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	LHGDN	18800312		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24498169, 28575098	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18363639, 29554016		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30487649		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	30487649	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	15671183		★☆☆☆☆ Found in Text Mining only
Langer Mesomelic Dysplasia Syndrome	Langer Mesomelic Dysplasia Syndrome	BEFREE	17394206, 24311385		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26367014		★☆☆☆☆ Found in Text Mining only
Leri-Weill dyschondrosteosis	Leri-Weill Dyschondrosteosis	BEFREE	16175500, 16941489, 17394206, 20412871, 21147883, 22020182, 22071895, 22791839, 24311385		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22187047, 24740120, 27819671		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27819671, 30925338		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18294295		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	15684063		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12645337, 16003238, 17323377, 20080160, 22023334, 22363234, 22940775, 23891548, 24798619, 25024626, 25353287, 25373316, 26058814, 27473374, 28187035, 28758812, 28834900, 28942083, 29246306, 29369785, 29554630, 30196987, 30271172, 30383541, 31533970, 31739702		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23891548, 31697926		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26504856	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	11466304	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29067470, 34949673	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22363234, 22940775, 28218408, 29554630, 29973476		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15563688, 30219079		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10720740, 21703428, 28173772, 9328171		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25268617	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16575839, 28883515		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21918980		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21918980, 39322061	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	20333728		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11964083, 16397244, 16925462, 17761971, 18056193, 18372913, 18757438, 18981011, 19010908, 19011999, 19123943, 19538737, 19746521, 20635135, 20846001, 21318602, 21799402, 21822552, 22593082, 22750628, 23287882, 24009311, 24177339, 24398324, 25386994, 26513020, 26600192, 27094683, 28622580, 30008831, 30172372, 30515835, 30822721, 31739702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12970323, 16875721		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21977915		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27906434		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	20840328		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27760163, 29973476, 31739702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21703428, 21882348, 24138209, 25268617, 31572459, 31759826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15455382, 18765524, 29848718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11964083, 15138580, 17935125, 24436106, 27810244, 28182192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11746265, 12429291, 15537383, 16245281, 17373694, 17974979, 19170048, 22050110, 24924803, 31642740		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22993310, 26783937		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28676933		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11964083, 16091733, 17373694, 17761706, 18308566, 18765524, 19149685, 19170048, 19941475, 20531417, 20840328, 21557443, 21799402, 22682129, 23413096, 23517743, 23921961, 25986685, 26600192, 27561454, 27769034, 28356150, 28961835, 29262538, 29468872, 29470550, 29654162, 29795022, 29977156, 30097713, 30726709, 31003438, 31782213, 31827085		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30093972, 30700181		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12707033, 18096695, 20041327, 20196838, 20531417, 21733184, 23170789, 23233043, 27279570		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10473093, 18757438, 22593082, 23897704, 26600192		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19010908		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25163932		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21378407, 22009534, 28041801		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25364818		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24721462, 25628225, 27041449, 28257661, 28756207, 29865786, 29886826, 31782213		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32659470	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29246152	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	20869355		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24362030, 24721462, 27041449, 28534176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	BEFREE	25505176		★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	22581587		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	22507623		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23303387		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25669983	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16476770		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28094938, 28262842		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25039279, 28094938, 28128444		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24312345, 28565918, 31602241, 9327770		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	23391721, 24759133		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26540312		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19269113		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	29360809		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29360809		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11395381, 11746265, 11964083, 12554695, 12645337, 12970323, 15867241, 16091733, 16288011, 17476297, 18757438, 18937843, 19424642, 19538737, 20531417, 21147226, 22682129, 23517743, 23539451, 23687338, 23919967, 24177339, 24436106, 24863967, 25163932, 26261495, 26934120, 27600331, 28173772, 28356150, 28697175, 29291033, 30635165, 31080557, 31123052, 31213575, 31598400, 31835848		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	27377607		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30683917		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16288011, 23619990, 30683917		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17215127	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28222093		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18294295		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	19940802, 27482056, 30120929, 31132328, 31668396		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	29019057		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27876249, 27878971, 28126518, 28173772		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24123874		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	20869355		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	24362030, 24721462, 26924429, 28756207, 29212764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26855179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30688539		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	12920130		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17279585, 22940495, 23413096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	17279585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	17279585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	17279585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15455382		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18765524, 29848718		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11964083, 15138580, 17935125, 23293110, 24436106, 27810244, 28182192		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24436106		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30566892, 34134622	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14706220, 16410750, 30185553		★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	22581587		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	26564991, 31175838		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26564991, 28120492, 28146220		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28565918		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28565918		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30779340		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	30779340	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30779340		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	17924967		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	20131237, 28883515		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	11258349, 8630505, 8755558, 8845846		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	19641190		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15905579		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15690482, 20416375, 26504856		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	16952547, 26504856		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	26247679		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11746265, 12429291, 15537383, 16245281, 17373694, 17974979, 19170048, 22050110, 24924803, 31642740		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16245281, 19170048		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22050110, 22986532, 23919967, 24924803	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15102084, 29458120		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	15102084		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24123874		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19307611		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17532472, 20971733, 23739922, 25689283		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	20840328		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23517743, 30511089		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25216639		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20442298		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15588074, 17328048, 21905006, 22294633, 24368568, 29566767		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	28836875	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12782970		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21591259, 28957875, 29343482		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	17476297		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	23832758		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15102084, 25912757, 28173772		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19860844		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23137910, 29470550, 40532857	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15625067, 23137910, 23479137, 26141049, 29470550		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28088683, 30515700		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22790967, 25182422, 25628225, 29123032, 29431616, 29995386, 30677459, 30989312		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	25182422		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22993310, 26783937		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	23710174		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	26189554		★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	28836875		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29851288		★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de Pointes	BEFREE	29297274		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29195005, 31711784		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	10931762, 16650979		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15236169, 16472590, 17262809, 17828778, 19184329, 19516190, 20627999, 21245992, 21830270, 27096966, 28742404		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	16472590, 17828778		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30132884		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	22533697	Associate	★☆☆☆☆ Found in Text Mining only
XX males	XX Males	BEFREE	12782970		★☆☆☆☆ Found in Text Mining only