Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8853
Gene name	ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
Gene symbol	ASAP2
Synonyms (NCBI Gene)	AMAP2CENTB3DDEF2PAG3PAPPap-alphaSHAG1
Chromosome	2
Chromosome location	2p25.1\|2p24
Summary	This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homol

365

Show/Hide all (365)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019707	hsa-miR-375	Microarray	20215506
MIRT626426	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT626425	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT626424	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT626423	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT626422	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT626421	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT626420	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT626419	hsa-miR-618	HITS-CLIP	23824327
MIRT626418	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT626417	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT626416	hsa-miR-4672	HITS-CLIP	23824327
MIRT441171	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441171	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT626426	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT626425	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT626424	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT626423	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT626422	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT626421	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT626420	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT626419	hsa-miR-618	HITS-CLIP	23824327
MIRT626418	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT626417	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT626416	hsa-miR-4672	HITS-CLIP	23824327
MIRT801755	hsa-miR-217	CLIP-seq
MIRT801756	hsa-miR-218	CLIP-seq
MIRT801757	hsa-miR-300	CLIP-seq
MIRT801758	hsa-miR-338-5p	CLIP-seq
MIRT801759	hsa-miR-340	CLIP-seq
MIRT801760	hsa-miR-34b	CLIP-seq
MIRT801761	hsa-miR-381	CLIP-seq
MIRT801762	hsa-miR-4477b	CLIP-seq
MIRT801763	hsa-miR-4666-3p	CLIP-seq
MIRT801764	hsa-miR-4789-5p	CLIP-seq
MIRT801765	hsa-miR-582-5p	CLIP-seq
MIRT801766	hsa-miR-944	CLIP-seq
MIRT801767	hsa-miR-105	CLIP-seq
MIRT801768	hsa-miR-145	CLIP-seq
MIRT801769	hsa-miR-151-3p	CLIP-seq
MIRT801770	hsa-miR-154	CLIP-seq
MIRT801771	hsa-miR-19a	CLIP-seq
MIRT801772	hsa-miR-19b	CLIP-seq
MIRT801773	hsa-miR-202	CLIP-seq
MIRT801774	hsa-miR-2053	CLIP-seq
MIRT801775	hsa-miR-219-5p	CLIP-seq
MIRT801776	hsa-miR-22	CLIP-seq
MIRT801777	hsa-miR-29a	CLIP-seq
MIRT801778	hsa-miR-29b	CLIP-seq
MIRT801779	hsa-miR-29c	CLIP-seq
MIRT801757	hsa-miR-300	CLIP-seq
MIRT801780	hsa-miR-302a	CLIP-seq
MIRT801781	hsa-miR-302b	CLIP-seq
MIRT801782	hsa-miR-302c	CLIP-seq
MIRT801783	hsa-miR-302d	CLIP-seq
MIRT801784	hsa-miR-302e	CLIP-seq
MIRT801785	hsa-miR-3065-5p	CLIP-seq
MIRT801786	hsa-miR-3120-5p	CLIP-seq
MIRT801787	hsa-miR-3121-3p	CLIP-seq
MIRT801788	hsa-miR-3147	CLIP-seq
MIRT801789	hsa-miR-3153	CLIP-seq
MIRT801758	hsa-miR-338-5p	CLIP-seq
MIRT801759	hsa-miR-340	CLIP-seq
MIRT801790	hsa-miR-3664-3p	CLIP-seq
MIRT801791	hsa-miR-3674	CLIP-seq
MIRT801792	hsa-miR-3685	CLIP-seq
MIRT801793	hsa-miR-372	CLIP-seq
MIRT801794	hsa-miR-373	CLIP-seq
MIRT801761	hsa-miR-381	CLIP-seq
MIRT801795	hsa-miR-384	CLIP-seq
MIRT801796	hsa-miR-3977	CLIP-seq
MIRT801797	hsa-miR-425	CLIP-seq
MIRT801798	hsa-miR-4273	CLIP-seq
MIRT801799	hsa-miR-4275	CLIP-seq
MIRT801800	hsa-miR-4310	CLIP-seq
MIRT801801	hsa-miR-4328	CLIP-seq
MIRT801802	hsa-miR-4425	CLIP-seq
MIRT801803	hsa-miR-4445	CLIP-seq
MIRT801804	hsa-miR-4463	CLIP-seq
MIRT801805	hsa-miR-4499	CLIP-seq
MIRT801806	hsa-miR-4520a-3p	CLIP-seq
MIRT801807	hsa-miR-4645-3p	CLIP-seq
MIRT801763	hsa-miR-4666-3p	CLIP-seq
MIRT801808	hsa-miR-4668-5p	CLIP-seq
MIRT801809	hsa-miR-4677-5p	CLIP-seq
MIRT801810	hsa-miR-4705	CLIP-seq
MIRT801811	hsa-miR-4719	CLIP-seq
MIRT801812	hsa-miR-4772-3p	CLIP-seq
MIRT801813	hsa-miR-4782-3p	CLIP-seq
MIRT801764	hsa-miR-4789-5p	CLIP-seq
MIRT801814	hsa-miR-495	CLIP-seq
MIRT801815	hsa-miR-501-3p	CLIP-seq
MIRT801816	hsa-miR-502-3p	CLIP-seq
MIRT801817	hsa-miR-508-3p	CLIP-seq
MIRT801818	hsa-miR-510	CLIP-seq
MIRT801819	hsa-miR-513b	CLIP-seq
MIRT801820	hsa-miR-519a	CLIP-seq
MIRT801821	hsa-miR-519b-3p	CLIP-seq
MIRT801822	hsa-miR-519c-3p	CLIP-seq
MIRT801823	hsa-miR-520a-3p	CLIP-seq
MIRT801824	hsa-miR-520b	CLIP-seq
MIRT801825	hsa-miR-520c-3p	CLIP-seq
MIRT801826	hsa-miR-520d-3p	CLIP-seq
MIRT801827	hsa-miR-520e	CLIP-seq
MIRT801828	hsa-miR-526b	CLIP-seq
MIRT801829	hsa-miR-543	CLIP-seq
MIRT801830	hsa-miR-548k	CLIP-seq
MIRT801831	hsa-miR-548n	CLIP-seq
MIRT801832	hsa-miR-659	CLIP-seq
MIRT801833	hsa-miR-767-5p	CLIP-seq
MIRT801834	hsa-miR-873	CLIP-seq
MIRT1936732	hsa-miR-1286	CLIP-seq
MIRT801768	hsa-miR-145	CLIP-seq
MIRT1936733	hsa-miR-153	CLIP-seq
MIRT1936734	hsa-miR-1827	CLIP-seq
MIRT801774	hsa-miR-2053	CLIP-seq
MIRT801775	hsa-miR-219-5p	CLIP-seq
MIRT801757	hsa-miR-300	CLIP-seq
MIRT801786	hsa-miR-3120-5p	CLIP-seq
MIRT801787	hsa-miR-3121-3p	CLIP-seq
MIRT1936735	hsa-miR-3163	CLIP-seq
MIRT1936736	hsa-miR-323-5p	CLIP-seq
MIRT801792	hsa-miR-3685	CLIP-seq
MIRT1936737	hsa-miR-3691-3p	CLIP-seq
MIRT801761	hsa-miR-381	CLIP-seq
MIRT801795	hsa-miR-384	CLIP-seq
MIRT1936738	hsa-miR-3908	CLIP-seq
MIRT1936739	hsa-miR-3929	CLIP-seq
MIRT1936740	hsa-miR-3942-5p	CLIP-seq
MIRT801798	hsa-miR-4273	CLIP-seq
MIRT801799	hsa-miR-4275	CLIP-seq
MIRT801801	hsa-miR-4328	CLIP-seq
MIRT1936741	hsa-miR-4419b	CLIP-seq
MIRT801803	hsa-miR-4445	CLIP-seq
MIRT1936742	hsa-miR-4478	CLIP-seq
MIRT1936743	hsa-miR-4640-5p	CLIP-seq
MIRT801763	hsa-miR-4666-3p	CLIP-seq
MIRT801809	hsa-miR-4677-5p	CLIP-seq
MIRT1936744	hsa-miR-4703-5p	CLIP-seq
MIRT801810	hsa-miR-4705	CLIP-seq
MIRT1936745	hsa-miR-4722-5p	CLIP-seq
MIRT1936746	hsa-miR-4726-5p	CLIP-seq
MIRT1936747	hsa-miR-4733-3p	CLIP-seq
MIRT1936748	hsa-miR-4766-3p	CLIP-seq
MIRT801813	hsa-miR-4782-3p	CLIP-seq
MIRT801764	hsa-miR-4789-5p	CLIP-seq
MIRT1936749	hsa-miR-487a	CLIP-seq
MIRT1936750	hsa-miR-488	CLIP-seq
MIRT801817	hsa-miR-508-3p	CLIP-seq
MIRT1936751	hsa-miR-508-5p	CLIP-seq
MIRT801819	hsa-miR-513b	CLIP-seq
MIRT801829	hsa-miR-543	CLIP-seq
MIRT1936752	hsa-miR-548ae	CLIP-seq
MIRT1936753	hsa-miR-548aj	CLIP-seq
MIRT1936754	hsa-miR-548am	CLIP-seq
MIRT801831	hsa-miR-548n	CLIP-seq
MIRT1936755	hsa-miR-548t	CLIP-seq
MIRT1936756	hsa-miR-548x	CLIP-seq
MIRT801834	hsa-miR-873	CLIP-seq
MIRT1936757	hsa-miR-940	CLIP-seq
MIRT801765	hsa-miR-582-5p	CLIP-seq
MIRT801774	hsa-miR-2053	CLIP-seq
MIRT801757	hsa-miR-300	CLIP-seq
MIRT2176529	hsa-miR-3647-3p	CLIP-seq
MIRT801761	hsa-miR-381	CLIP-seq
MIRT801803	hsa-miR-4445	CLIP-seq
MIRT801763	hsa-miR-4666-3p	CLIP-seq
MIRT801812	hsa-miR-4772-3p	CLIP-seq
MIRT801829	hsa-miR-543	CLIP-seq
MIRT801767	hsa-miR-105	CLIP-seq
MIRT1936732	hsa-miR-1286	CLIP-seq
MIRT2176530	hsa-miR-199a-3p	CLIP-seq
MIRT2176531	hsa-miR-199b-3p	CLIP-seq
MIRT801774	hsa-miR-2053	CLIP-seq
MIRT801755	hsa-miR-217	CLIP-seq
MIRT2176532	hsa-miR-3129-5p	CLIP-seq
MIRT2176533	hsa-miR-3134	CLIP-seq
MIRT1936735	hsa-miR-3163	CLIP-seq
MIRT1936736	hsa-miR-323-5p	CLIP-seq
MIRT801759	hsa-miR-340	CLIP-seq
MIRT2176529	hsa-miR-3647-3p	CLIP-seq
MIRT801795	hsa-miR-384	CLIP-seq
MIRT1936739	hsa-miR-3929	CLIP-seq
MIRT2176534	hsa-miR-4303	CLIP-seq
MIRT801801	hsa-miR-4328	CLIP-seq
MIRT1936741	hsa-miR-4419b	CLIP-seq
MIRT801803	hsa-miR-4445	CLIP-seq
MIRT1936742	hsa-miR-4478	CLIP-seq
MIRT2176535	hsa-miR-4502	CLIP-seq
MIRT2176536	hsa-miR-4534	CLIP-seq
MIRT2176537	hsa-miR-4666-5p	CLIP-seq
MIRT801810	hsa-miR-4705	CLIP-seq
MIRT1936745	hsa-miR-4722-5p	CLIP-seq
MIRT1936747	hsa-miR-4733-3p	CLIP-seq
MIRT801812	hsa-miR-4772-3p	CLIP-seq
MIRT1936749	hsa-miR-487a	CLIP-seq
MIRT801815	hsa-miR-501-3p	CLIP-seq
MIRT801816	hsa-miR-502-3p	CLIP-seq
MIRT2176538	hsa-miR-570	CLIP-seq
MIRT801765	hsa-miR-582-5p	CLIP-seq
MIRT801833	hsa-miR-767-5p	CLIP-seq
MIRT801834	hsa-miR-873	CLIP-seq
MIRT2176539	hsa-miR-936	CLIP-seq
MIRT1936735	hsa-miR-3163	CLIP-seq
MIRT1936736	hsa-miR-323-5p	CLIP-seq
MIRT1936739	hsa-miR-3929	CLIP-seq
MIRT1936741	hsa-miR-4419b	CLIP-seq
MIRT1936742	hsa-miR-4478	CLIP-seq
MIRT1936747	hsa-miR-4733-3p	CLIP-seq
MIRT801767	hsa-miR-105	CLIP-seq
MIRT801785	hsa-miR-3065-5p	CLIP-seq
MIRT801800	hsa-miR-4310	CLIP-seq
MIRT801800	hsa-miR-4310	CLIP-seq
MIRT2479851	hsa-miR-1283	CLIP-seq
MIRT1936732	hsa-miR-1286	CLIP-seq
MIRT2479852	hsa-miR-1302	CLIP-seq
MIRT801769	hsa-miR-151-3p	CLIP-seq
MIRT2479853	hsa-miR-190	CLIP-seq
MIRT2479854	hsa-miR-190b	CLIP-seq
MIRT801771	hsa-miR-19a	CLIP-seq
MIRT801772	hsa-miR-19b	CLIP-seq
MIRT801774	hsa-miR-2053	CLIP-seq
MIRT801777	hsa-miR-29a	CLIP-seq
MIRT801778	hsa-miR-29b	CLIP-seq
MIRT801779	hsa-miR-29c	CLIP-seq
MIRT801780	hsa-miR-302a	CLIP-seq
MIRT801781	hsa-miR-302b	CLIP-seq
MIRT801782	hsa-miR-302c	CLIP-seq
MIRT801783	hsa-miR-302d	CLIP-seq
MIRT801784	hsa-miR-302e	CLIP-seq
MIRT801787	hsa-miR-3121-3p	CLIP-seq
MIRT2479855	hsa-miR-3122	CLIP-seq
MIRT2479856	hsa-miR-3129-3p	CLIP-seq
MIRT2479857	hsa-miR-3140-3p	CLIP-seq
MIRT2479858	hsa-miR-3148	CLIP-seq
MIRT1936735	hsa-miR-3163	CLIP-seq
MIRT2479859	hsa-miR-3168	CLIP-seq
MIRT2479860	hsa-miR-3179	CLIP-seq
MIRT2479861	hsa-miR-3199	CLIP-seq
MIRT1936736	hsa-miR-323-5p	CLIP-seq
MIRT2479862	hsa-miR-331-5p	CLIP-seq
MIRT2479863	hsa-miR-3646	CLIP-seq
MIRT2176529	hsa-miR-3647-3p	CLIP-seq
MIRT801791	hsa-miR-3674	CLIP-seq
MIRT801792	hsa-miR-3685	CLIP-seq
MIRT801793	hsa-miR-372	CLIP-seq
MIRT801794	hsa-miR-373	CLIP-seq
MIRT801795	hsa-miR-384	CLIP-seq
MIRT2479864	hsa-miR-3913-5p	CLIP-seq
MIRT2479865	hsa-miR-3924	CLIP-seq
MIRT1936739	hsa-miR-3929	CLIP-seq
MIRT2479866	hsa-miR-409-3p	CLIP-seq
MIRT2479867	hsa-miR-4279	CLIP-seq
MIRT2479868	hsa-miR-4298	CLIP-seq
MIRT2479869	hsa-miR-4307	CLIP-seq
MIRT1936741	hsa-miR-4419b	CLIP-seq
MIRT801803	hsa-miR-4445	CLIP-seq
MIRT2479870	hsa-miR-4459	CLIP-seq
MIRT801804	hsa-miR-4463	CLIP-seq
MIRT1936742	hsa-miR-4478	CLIP-seq
MIRT2479871	hsa-miR-4490	CLIP-seq
MIRT801805	hsa-miR-4499	CLIP-seq
MIRT2479872	hsa-miR-450b-5p	CLIP-seq
MIRT2479873	hsa-miR-4515	CLIP-seq
MIRT2479874	hsa-miR-4524	CLIP-seq
MIRT2479875	hsa-miR-4653-3p	CLIP-seq
MIRT2479876	hsa-miR-4678	CLIP-seq
MIRT2479877	hsa-miR-4690-5p	CLIP-seq
MIRT2479878	hsa-miR-4708-3p	CLIP-seq
MIRT2479879	hsa-miR-4712-3p	CLIP-seq
MIRT1936745	hsa-miR-4722-5p	CLIP-seq
MIRT1936747	hsa-miR-4733-3p	CLIP-seq
MIRT2479880	hsa-miR-4753-3p	CLIP-seq
MIRT2479881	hsa-miR-4768-5p	CLIP-seq
MIRT2479882	hsa-miR-4774-5p	CLIP-seq
MIRT2479883	hsa-miR-4775	CLIP-seq
MIRT2479884	hsa-miR-4803	CLIP-seq
MIRT2479885	hsa-miR-494	CLIP-seq
MIRT801820	hsa-miR-519a	CLIP-seq
MIRT801821	hsa-miR-519b-3p	CLIP-seq
MIRT801822	hsa-miR-519c-3p	CLIP-seq
MIRT801823	hsa-miR-520a-3p	CLIP-seq
MIRT801824	hsa-miR-520b	CLIP-seq
MIRT801825	hsa-miR-520c-3p	CLIP-seq
MIRT801826	hsa-miR-520d-3p	CLIP-seq
MIRT801827	hsa-miR-520e	CLIP-seq
MIRT2479886	hsa-miR-539	CLIP-seq
MIRT2479887	hsa-miR-576-5p	CLIP-seq
MIRT2479888	hsa-miR-875-3p	CLIP-seq
MIRT2479889	hsa-miR-889	CLIP-seq
MIRT801787	hsa-miR-3121-3p	CLIP-seq
MIRT2479851	hsa-miR-1283	CLIP-seq
MIRT1936732	hsa-miR-1286	CLIP-seq
MIRT2479852	hsa-miR-1302	CLIP-seq
MIRT801769	hsa-miR-151-3p	CLIP-seq
MIRT2479853	hsa-miR-190	CLIP-seq
MIRT2479854	hsa-miR-190b	CLIP-seq
MIRT801771	hsa-miR-19a	CLIP-seq
MIRT801772	hsa-miR-19b	CLIP-seq
MIRT801774	hsa-miR-2053	CLIP-seq
MIRT801777	hsa-miR-29a	CLIP-seq
MIRT801778	hsa-miR-29b	CLIP-seq
MIRT801779	hsa-miR-29c	CLIP-seq
MIRT801780	hsa-miR-302a	CLIP-seq
MIRT801781	hsa-miR-302b	CLIP-seq
MIRT801782	hsa-miR-302c	CLIP-seq
MIRT801783	hsa-miR-302d	CLIP-seq
MIRT801784	hsa-miR-302e	CLIP-seq
MIRT801787	hsa-miR-3121-3p	CLIP-seq
MIRT2479855	hsa-miR-3122	CLIP-seq
MIRT2479856	hsa-miR-3129-3p	CLIP-seq
MIRT2479857	hsa-miR-3140-3p	CLIP-seq
MIRT2479858	hsa-miR-3148	CLIP-seq
MIRT1936735	hsa-miR-3163	CLIP-seq
MIRT2479859	hsa-miR-3168	CLIP-seq
MIRT2479860	hsa-miR-3179	CLIP-seq
MIRT2479861	hsa-miR-3199	CLIP-seq
MIRT1936736	hsa-miR-323-5p	CLIP-seq
MIRT2479862	hsa-miR-331-5p	CLIP-seq
MIRT2479863	hsa-miR-3646	CLIP-seq
MIRT2176529	hsa-miR-3647-3p	CLIP-seq
MIRT801791	hsa-miR-3674	CLIP-seq
MIRT801792	hsa-miR-3685	CLIP-seq
MIRT801793	hsa-miR-372	CLIP-seq
MIRT801794	hsa-miR-373	CLIP-seq
MIRT801795	hsa-miR-384	CLIP-seq
MIRT2479864	hsa-miR-3913-5p	CLIP-seq
MIRT2479865	hsa-miR-3924	CLIP-seq
MIRT1936739	hsa-miR-3929	CLIP-seq
MIRT2479866	hsa-miR-409-3p	CLIP-seq
MIRT2479868	hsa-miR-4298	CLIP-seq
MIRT2479869	hsa-miR-4307	CLIP-seq
MIRT1936741	hsa-miR-4419b	CLIP-seq
MIRT801803	hsa-miR-4445	CLIP-seq
MIRT2479870	hsa-miR-4459	CLIP-seq
MIRT801804	hsa-miR-4463	CLIP-seq
MIRT1936742	hsa-miR-4478	CLIP-seq
MIRT801805	hsa-miR-4499	CLIP-seq
MIRT2479872	hsa-miR-450b-5p	CLIP-seq
MIRT2479873	hsa-miR-4515	CLIP-seq
MIRT2479874	hsa-miR-4524	CLIP-seq
MIRT2479875	hsa-miR-4653-3p	CLIP-seq
MIRT2479876	hsa-miR-4678	CLIP-seq
MIRT2479877	hsa-miR-4690-5p	CLIP-seq
MIRT2479878	hsa-miR-4708-3p	CLIP-seq
MIRT2479879	hsa-miR-4712-3p	CLIP-seq
MIRT1936745	hsa-miR-4722-5p	CLIP-seq
MIRT1936747	hsa-miR-4733-3p	CLIP-seq
MIRT2479880	hsa-miR-4753-3p	CLIP-seq
MIRT2479881	hsa-miR-4768-5p	CLIP-seq
MIRT2479883	hsa-miR-4775	CLIP-seq
MIRT2479884	hsa-miR-4803	CLIP-seq
MIRT2479885	hsa-miR-494	CLIP-seq
MIRT801820	hsa-miR-519a	CLIP-seq
MIRT801821	hsa-miR-519b-3p	CLIP-seq
MIRT801822	hsa-miR-519c-3p	CLIP-seq
MIRT801823	hsa-miR-520a-3p	CLIP-seq
MIRT801824	hsa-miR-520b	CLIP-seq
MIRT801825	hsa-miR-520c-3p	CLIP-seq
MIRT801826	hsa-miR-520d-3p	CLIP-seq
MIRT801827	hsa-miR-520e	CLIP-seq
MIRT2479886	hsa-miR-539	CLIP-seq
MIRT2479887	hsa-miR-576-5p	CLIP-seq
MIRT2479888	hsa-miR-875-3p	CLIP-seq
MIRT2479889	hsa-miR-889	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CTCF	Unknown	23999061
VDR	Unknown	23999061

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	11716503, 17255943, 17474147, 18786926, 20936779, 21706016, 25416956, 31980649, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
603817	2721	ENSG00000151693

O43150

Protein name

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (Development and differentiation-enhancing factor 2) (Paxillin-associated protein with ARF GAP activity 3) (PAG3) (Pyk2 C-terminus-associated protein) (PAP)

Protein function

Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16746	BAR_3	31 → 266		Domain
PF00169	PH	306 → 397	PH domain	Domain
PF01412	ArfGap	421 → 539	Putative GTPase activating protein for Arf	Domain
PF00023	Ank	620 → 652	Ankyrin repeat	Repeat
PF14604	SH3_9	951 → 1002	Variant SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, brain, placenta, kidney, monocytes and pancreas. {ECO:0000269|PubMed:10022920}.

Sequence

MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD

Sequence length

1006

Interactions

View interactions

	KEGG
	Endocytosis Fc gamma R-mediated phagocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (63)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30050497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40033250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	17481701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	39209956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30373693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38320622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	11042905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25230976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25684462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	16023184, 21558960, 30374649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25684462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19349390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31037993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31325218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10901369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis laxa, x-linked	Cutis Laxa, X-Linked	BEFREE	28449486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10973238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	39209956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24434023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24434023		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	26171400, 30583904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26171400, 30583904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28705939, 29099661, 31810742		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7678881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28704174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28656348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10328217, 23023232, 29328473, 31785151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25684462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20944657		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	29328473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29672450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29672450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	BEFREE	24712572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10973238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30021578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28656348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	26187439, 28656348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28449889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	24198235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	24198235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27707436, 29200833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Postaxial polydactyly type A	Polydactyly	BEFREE	11543628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16631469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	31252268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19349390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	7729772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28705939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	7678881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	28449889, 29066589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27707436, 28822020, 28878129, 29200833, 30420826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30373693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34486534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
STOMATOCYTOSIS I	Stomatocytosis	BEFREE	28449486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28705939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	28699846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicocele	Varicocele	BEFREE	24992177		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked recessive nephrolithiasis with renal failure	Nephrolithiasis With Renal Failure, X-Linked	BEFREE	30081763		★★★★★ ★☆☆☆☆ Found in Text Mining only

ASAP2 (ArfGAP with SH3 domain, ankyrin repeat and PH domain 2)