CDK5R1 (cyclin dependent kinase 5 regulatory subunit 1)

Gene

• Entrez ID: 8851
• Gene name: Cyclin dependent kinase 5 regulatory subunit 1
• Gene symbol: CDK5R1
• Synonyms (NCBI Gene): CDK5P35, CDK5R, NCK5A, p23, p25, p35, p35nck5a
• Chromosome: 17
• Chromosome location: 17q11.2
• Summary: The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029817	hsa-miR-26b-5p	Microarray	19088304
MIRT042678	hsa-miR-196b-5p	CLASH	23622248
MIRT054108	hsa-miR-1207-5p	Microarray	22995316
MIRT250939	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT250940	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT250943	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT250942	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT286706	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT250951	hsa-miR-548ac	PAR-CLIP	20371350
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT250949	hsa-miR-548z	PAR-CLIP	20371350
MIRT250950	hsa-miR-548aa	PAR-CLIP	20371350
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT286719	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT250948	hsa-miR-548v	PAR-CLIP	20371350
MIRT548927	hsa-miR-7703	PAR-CLIP	20371350
MIRT548926	hsa-miR-4325	PAR-CLIP	20371350
MIRT250939	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT250940	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT250943	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT250942	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT286706	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT250951	hsa-miR-548ac	PAR-CLIP	20371350
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT250949	hsa-miR-548z	PAR-CLIP	20371350
MIRT250950	hsa-miR-548aa	PAR-CLIP	20371350
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT286719	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT250948	hsa-miR-548v	PAR-CLIP	20371350
MIRT548927	hsa-miR-7703	PAR-CLIP	20371350
MIRT548926	hsa-miR-4325	PAR-CLIP	20371350
MIRT286706	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT250939	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT250940	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT250943	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT250942	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT558811	hsa-miR-133b	PAR-CLIP	21572407
MIRT558810	hsa-miR-133a-3p	PAR-CLIP	21572407
MIRT250951	hsa-miR-548ac	PAR-CLIP	21572407
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT250949	hsa-miR-548z	PAR-CLIP	21572407
MIRT250950	hsa-miR-548aa	PAR-CLIP	21572407
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT286719	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT250948	hsa-miR-548v	PAR-CLIP	21572407
MIRT548927	hsa-miR-7703	PAR-CLIP	21572407
MIRT548926	hsa-miR-4325	PAR-CLIP	21572407
MIRT558809	hsa-miR-5587-5p	PAR-CLIP	21572407
MIRT250939	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT250940	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT250943	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT250942	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT250951	hsa-miR-548ac	PAR-CLIP	21572407
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT250949	hsa-miR-548z	PAR-CLIP	21572407
MIRT250950	hsa-miR-548aa	PAR-CLIP	21572407
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT250948	hsa-miR-548v	PAR-CLIP	21572407
MIRT548927	hsa-miR-7703	PAR-CLIP	21572407
MIRT548926	hsa-miR-4325	PAR-CLIP	21572407
MIRT250939	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT250940	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT250943	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT250942	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT286706	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT250951	hsa-miR-548ac	PAR-CLIP	20371350
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT250949	hsa-miR-548z	PAR-CLIP	20371350
MIRT250950	hsa-miR-548aa	PAR-CLIP	20371350
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT286719	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT250948	hsa-miR-548v	PAR-CLIP	20371350
MIRT548927	hsa-miR-7703	PAR-CLIP	20371350
MIRT548926	hsa-miR-4325	PAR-CLIP	20371350
MIRT250939	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT250940	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT250943	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT250942	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT286706	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT250951	hsa-miR-548ac	PAR-CLIP	20371350
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT250949	hsa-miR-548z	PAR-CLIP	20371350
MIRT250950	hsa-miR-548aa	PAR-CLIP	20371350
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT286719	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT250948	hsa-miR-548v	PAR-CLIP	20371350
MIRT548927	hsa-miR-7703	PAR-CLIP	20371350
MIRT548926	hsa-miR-4325	PAR-CLIP	20371350
MIRT286706	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT250939	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT250940	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT250943	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT250942	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT558811	hsa-miR-133b	PAR-CLIP	21572407
MIRT558810	hsa-miR-133a-3p	PAR-CLIP	21572407
MIRT250951	hsa-miR-548ac	PAR-CLIP	21572407
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT250949	hsa-miR-548z	PAR-CLIP	21572407
MIRT250950	hsa-miR-548aa	PAR-CLIP	21572407
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT286719	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT250948	hsa-miR-548v	PAR-CLIP	21572407
MIRT548927	hsa-miR-7703	PAR-CLIP	21572407
MIRT548926	hsa-miR-4325	PAR-CLIP	21572407
MIRT558809	hsa-miR-5587-5p	PAR-CLIP	21572407
MIRT250939	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT250944	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT250941	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT250940	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT250943	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT250942	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT250951	hsa-miR-548ac	PAR-CLIP	21572407
MIRT250954	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT250945	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT250946	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT250949	hsa-miR-548z	PAR-CLIP	21572407
MIRT250950	hsa-miR-548aa	PAR-CLIP	21572407
MIRT250952	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT250947	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT250948	hsa-miR-548v	PAR-CLIP	21572407
MIRT548927	hsa-miR-7703	PAR-CLIP	21572407
MIRT548926	hsa-miR-4325	PAR-CLIP	21572407
MIRT756258	hsa-miR-148a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35024240
MIRT881192	hsa-miR-103a	CLIP-seq
MIRT881193	hsa-miR-103b	CLIP-seq
MIRT881194	hsa-miR-107	CLIP-seq
MIRT881195	hsa-miR-1224-3p	CLIP-seq
MIRT881196	hsa-miR-1236	CLIP-seq
MIRT881197	hsa-miR-1254	CLIP-seq
MIRT881198	hsa-miR-1273e	CLIP-seq
MIRT881199	hsa-miR-1297	CLIP-seq
MIRT881200	hsa-miR-1302	CLIP-seq
MIRT881201	hsa-miR-130a	CLIP-seq
MIRT881202	hsa-miR-130b	CLIP-seq
MIRT881203	hsa-miR-148a	CLIP-seq
MIRT881204	hsa-miR-148b	CLIP-seq
MIRT881205	hsa-miR-152	CLIP-seq
MIRT881206	hsa-miR-15a	CLIP-seq
MIRT881207	hsa-miR-15b	CLIP-seq
MIRT881208	hsa-miR-16	CLIP-seq
MIRT881209	hsa-miR-1825	CLIP-seq
MIRT881210	hsa-miR-185	CLIP-seq
MIRT881211	hsa-miR-195	CLIP-seq
MIRT881212	hsa-miR-199a-3p	CLIP-seq
MIRT881213	hsa-miR-199b-3p	CLIP-seq
MIRT881214	hsa-miR-200b	CLIP-seq
MIRT881215	hsa-miR-200c	CLIP-seq
MIRT881216	hsa-miR-2113	CLIP-seq
MIRT881217	hsa-miR-2355-5p	CLIP-seq
MIRT881218	hsa-miR-26a	CLIP-seq
MIRT881219	hsa-miR-26b	CLIP-seq
MIRT881220	hsa-miR-27a	CLIP-seq
MIRT881221	hsa-miR-27b	CLIP-seq
MIRT881222	hsa-miR-2861	CLIP-seq
MIRT881223	hsa-miR-301a	CLIP-seq
MIRT881224	hsa-miR-301b	CLIP-seq
MIRT881225	hsa-miR-3074-3p	CLIP-seq
MIRT881226	hsa-miR-3116	CLIP-seq
MIRT881227	hsa-miR-3122	CLIP-seq
MIRT881228	hsa-miR-3129-5p	CLIP-seq
MIRT881229	hsa-miR-3155	CLIP-seq
MIRT881230	hsa-miR-3155b	CLIP-seq
MIRT881231	hsa-miR-3160-5p	CLIP-seq
MIRT881232	hsa-miR-3175	CLIP-seq
MIRT881233	hsa-miR-3192	CLIP-seq
MIRT881234	hsa-miR-3199	CLIP-seq
MIRT881235	hsa-miR-323-3p	CLIP-seq
MIRT881236	hsa-miR-323b-3p	CLIP-seq
MIRT881237	hsa-miR-326	CLIP-seq
MIRT881238	hsa-miR-330-5p	CLIP-seq
MIRT881239	hsa-miR-338-5p	CLIP-seq
MIRT881240	hsa-miR-340	CLIP-seq
MIRT881241	hsa-miR-3666	CLIP-seq
MIRT881242	hsa-miR-376a	CLIP-seq
MIRT881243	hsa-miR-376b	CLIP-seq
MIRT881244	hsa-miR-377	CLIP-seq
MIRT881245	hsa-miR-3913-5p	CLIP-seq
MIRT881246	hsa-miR-3925-5p	CLIP-seq
MIRT881247	hsa-miR-3941	CLIP-seq
MIRT881248	hsa-miR-424	CLIP-seq
MIRT881249	hsa-miR-4268	CLIP-seq
MIRT881250	hsa-miR-4272	CLIP-seq
MIRT881251	hsa-miR-4286	CLIP-seq
MIRT881252	hsa-miR-429	CLIP-seq
MIRT881253	hsa-miR-4295	CLIP-seq
MIRT881254	hsa-miR-4298	CLIP-seq
MIRT881255	hsa-miR-4306	CLIP-seq
MIRT881256	hsa-miR-4314	CLIP-seq
MIRT881257	hsa-miR-4326	CLIP-seq
MIRT881258	hsa-miR-4327	CLIP-seq
MIRT881259	hsa-miR-433	CLIP-seq
MIRT881260	hsa-miR-4438	CLIP-seq
MIRT881261	hsa-miR-4448	CLIP-seq
MIRT881262	hsa-miR-4465	CLIP-seq
MIRT881263	hsa-miR-4470	CLIP-seq
MIRT881264	hsa-miR-4502	CLIP-seq
MIRT881265	hsa-miR-4506	CLIP-seq
MIRT881266	hsa-miR-4515	CLIP-seq
MIRT881267	hsa-miR-4524	CLIP-seq
MIRT881268	hsa-miR-454	CLIP-seq
MIRT881269	hsa-miR-4644	CLIP-seq
MIRT881270	hsa-miR-4646-5p	CLIP-seq
MIRT881271	hsa-miR-466	CLIP-seq
MIRT881272	hsa-miR-4671-3p	CLIP-seq
MIRT881273	hsa-miR-4672	CLIP-seq
MIRT881274	hsa-miR-4708-3p	CLIP-seq
MIRT881275	hsa-miR-4731-3p	CLIP-seq
MIRT881276	hsa-miR-4801	CLIP-seq
MIRT881277	hsa-miR-484	CLIP-seq
MIRT881278	hsa-miR-497	CLIP-seq
MIRT881279	hsa-miR-503	CLIP-seq
MIRT881280	hsa-miR-513a-3p	CLIP-seq
MIRT881281	hsa-miR-513a-5p	CLIP-seq
MIRT881282	hsa-miR-548ae	CLIP-seq
MIRT881283	hsa-miR-548aj	CLIP-seq
MIRT881284	hsa-miR-548am	CLIP-seq
MIRT881285	hsa-miR-548n	CLIP-seq
MIRT881286	hsa-miR-548t	CLIP-seq
MIRT881287	hsa-miR-548x	CLIP-seq
MIRT881288	hsa-miR-599	CLIP-seq
MIRT881289	hsa-miR-646	CLIP-seq
MIRT881290	hsa-miR-653	CLIP-seq
MIRT881291	hsa-miR-7	CLIP-seq
MIRT881292	hsa-miR-936	CLIP-seq
MIRT1961017	hsa-miR-101	CLIP-seq
MIRT881192	hsa-miR-103a	CLIP-seq
MIRT881193	hsa-miR-103b	CLIP-seq
MIRT881194	hsa-miR-107	CLIP-seq
MIRT881206	hsa-miR-15a	CLIP-seq
MIRT881207	hsa-miR-15b	CLIP-seq
MIRT881208	hsa-miR-16	CLIP-seq
MIRT881211	hsa-miR-195	CLIP-seq
MIRT1961018	hsa-miR-197	CLIP-seq
MIRT1961019	hsa-miR-214	CLIP-seq
MIRT881225	hsa-miR-3074-3p	CLIP-seq
MIRT1961020	hsa-miR-361-3p	CLIP-seq
MIRT1961021	hsa-miR-3619-5p	CLIP-seq
MIRT1961022	hsa-miR-3679-3p	CLIP-seq
MIRT881242	hsa-miR-376a	CLIP-seq
MIRT881243	hsa-miR-376b	CLIP-seq
MIRT881248	hsa-miR-424	CLIP-seq
MIRT1961023	hsa-miR-4291	CLIP-seq
MIRT881263	hsa-miR-4470	CLIP-seq
MIRT881265	hsa-miR-4506	CLIP-seq
MIRT881267	hsa-miR-4524	CLIP-seq
MIRT1961024	hsa-miR-4690-5p	CLIP-seq
MIRT1961025	hsa-miR-4736	CLIP-seq
MIRT1961026	hsa-miR-4763-3p	CLIP-seq
MIRT881278	hsa-miR-497	CLIP-seq
MIRT881279	hsa-miR-503	CLIP-seq
MIRT881285	hsa-miR-548n	CLIP-seq
MIRT881286	hsa-miR-548t	CLIP-seq
MIRT881289	hsa-miR-646	CLIP-seq
MIRT881290	hsa-miR-653	CLIP-seq
MIRT1961027	hsa-miR-761	CLIP-seq
MIRT1961028	hsa-miR-922	CLIP-seq
MIRT881192	hsa-miR-103a	CLIP-seq
MIRT881193	hsa-miR-103b	CLIP-seq
MIRT881194	hsa-miR-107	CLIP-seq
MIRT881195	hsa-miR-1224-3p	CLIP-seq
MIRT881196	hsa-miR-1236	CLIP-seq
MIRT881198	hsa-miR-1273e	CLIP-seq
MIRT2197754	hsa-miR-1293	CLIP-seq
MIRT881199	hsa-miR-1297	CLIP-seq
MIRT881201	hsa-miR-130a	CLIP-seq
MIRT881202	hsa-miR-130b	CLIP-seq
MIRT881203	hsa-miR-148a	CLIP-seq
MIRT881204	hsa-miR-148b	CLIP-seq
MIRT881205	hsa-miR-152	CLIP-seq
MIRT881206	hsa-miR-15a	CLIP-seq
MIRT881207	hsa-miR-15b	CLIP-seq
MIRT881208	hsa-miR-16	CLIP-seq
MIRT881209	hsa-miR-1825	CLIP-seq
MIRT881210	hsa-miR-185	CLIP-seq
MIRT881211	hsa-miR-195	CLIP-seq
MIRT881214	hsa-miR-200b	CLIP-seq
MIRT881215	hsa-miR-200c	CLIP-seq
MIRT2197755	hsa-miR-2117	CLIP-seq
MIRT881217	hsa-miR-2355-5p	CLIP-seq
MIRT881218	hsa-miR-26a	CLIP-seq
MIRT881219	hsa-miR-26b	CLIP-seq
MIRT881220	hsa-miR-27a	CLIP-seq
MIRT881221	hsa-miR-27b	CLIP-seq
MIRT881222	hsa-miR-2861	CLIP-seq
MIRT881223	hsa-miR-301a	CLIP-seq
MIRT881224	hsa-miR-301b	CLIP-seq
MIRT881225	hsa-miR-3074-3p	CLIP-seq
MIRT881229	hsa-miR-3155	CLIP-seq
MIRT881230	hsa-miR-3155b	CLIP-seq
MIRT2197756	hsa-miR-3166	CLIP-seq
MIRT881232	hsa-miR-3175	CLIP-seq
MIRT881233	hsa-miR-3192	CLIP-seq
MIRT881237	hsa-miR-326	CLIP-seq
MIRT881238	hsa-miR-330-5p	CLIP-seq
MIRT881239	hsa-miR-338-5p	CLIP-seq
MIRT881240	hsa-miR-340	CLIP-seq
MIRT2197757	hsa-miR-3652	CLIP-seq
MIRT881241	hsa-miR-3666	CLIP-seq
MIRT2197758	hsa-miR-3677-5p	CLIP-seq
MIRT2197759	hsa-miR-3680	CLIP-seq
MIRT881242	hsa-miR-376a	CLIP-seq
MIRT881243	hsa-miR-376b	CLIP-seq
MIRT881244	hsa-miR-377	CLIP-seq
MIRT881246	hsa-miR-3925-5p	CLIP-seq
MIRT881247	hsa-miR-3941	CLIP-seq
MIRT881248	hsa-miR-424	CLIP-seq
MIRT2197760	hsa-miR-4261	CLIP-seq
MIRT2197761	hsa-miR-4273	CLIP-seq
MIRT881251	hsa-miR-4286	CLIP-seq
MIRT881252	hsa-miR-429	CLIP-seq
MIRT881253	hsa-miR-4295	CLIP-seq
MIRT2197762	hsa-miR-4300	CLIP-seq
MIRT881255	hsa-miR-4306	CLIP-seq
MIRT881256	hsa-miR-4314	CLIP-seq
MIRT881257	hsa-miR-4326	CLIP-seq
MIRT881258	hsa-miR-4327	CLIP-seq
MIRT881259	hsa-miR-433	CLIP-seq
MIRT2197763	hsa-miR-4427	CLIP-seq
MIRT2197764	hsa-miR-4430	CLIP-seq
MIRT881260	hsa-miR-4438	CLIP-seq
MIRT881261	hsa-miR-4448	CLIP-seq
MIRT881262	hsa-miR-4465	CLIP-seq
MIRT881263	hsa-miR-4470	CLIP-seq
MIRT2197765	hsa-miR-4483	CLIP-seq
MIRT881264	hsa-miR-4502	CLIP-seq
MIRT2197766	hsa-miR-4505	CLIP-seq
MIRT881265	hsa-miR-4506	CLIP-seq
MIRT881267	hsa-miR-4524	CLIP-seq
MIRT2197767	hsa-miR-4530	CLIP-seq
MIRT881268	hsa-miR-454	CLIP-seq
MIRT2197768	hsa-miR-4643	CLIP-seq
MIRT881269	hsa-miR-4644	CLIP-seq
MIRT881270	hsa-miR-4646-5p	CLIP-seq
MIRT881271	hsa-miR-466	CLIP-seq
MIRT881273	hsa-miR-4672	CLIP-seq
MIRT2197769	hsa-miR-4680-3p	CLIP-seq
MIRT881274	hsa-miR-4708-3p	CLIP-seq
MIRT2197770	hsa-miR-4719	CLIP-seq
MIRT881275	hsa-miR-4731-3p	CLIP-seq
MIRT2197771	hsa-miR-4789-3p	CLIP-seq
MIRT2197772	hsa-miR-4798-3p	CLIP-seq
MIRT881276	hsa-miR-4801	CLIP-seq
MIRT881277	hsa-miR-484	CLIP-seq
MIRT881278	hsa-miR-497	CLIP-seq
MIRT881279	hsa-miR-503	CLIP-seq
MIRT881281	hsa-miR-513a-5p	CLIP-seq
MIRT881285	hsa-miR-548n	CLIP-seq
MIRT881286	hsa-miR-548t	CLIP-seq
MIRT2197773	hsa-miR-603	CLIP-seq
MIRT881289	hsa-miR-646	CLIP-seq
MIRT2197774	hsa-miR-661	CLIP-seq
MIRT2197775	hsa-miR-760	CLIP-seq
MIRT2197776	hsa-miR-891a	CLIP-seq
MIRT2197777	hsa-miR-920	CLIP-seq
MIRT1961028	hsa-miR-922	CLIP-seq
MIRT881198	hsa-miR-1273e	CLIP-seq
MIRT881199	hsa-miR-1297	CLIP-seq
MIRT881203	hsa-miR-148a	CLIP-seq
MIRT881204	hsa-miR-148b	CLIP-seq
MIRT881205	hsa-miR-152	CLIP-seq
MIRT881218	hsa-miR-26a	CLIP-seq
MIRT881219	hsa-miR-26b	CLIP-seq
MIRT881225	hsa-miR-3074-3p	CLIP-seq
MIRT881258	hsa-miR-4327	CLIP-seq
MIRT881262	hsa-miR-4465	CLIP-seq
MIRT881263	hsa-miR-4470	CLIP-seq
MIRT881265	hsa-miR-4506	CLIP-seq
MIRT881236	hsa-miR-323b-3p	CLIP-seq
MIRT2446699	hsa-miR-4292	CLIP-seq
MIRT2446700	hsa-miR-4308	CLIP-seq
MIRT2446701	hsa-miR-4514	CLIP-seq
MIRT2446702	hsa-miR-4640-5p	CLIP-seq
MIRT2446703	hsa-miR-4645-5p	CLIP-seq
MIRT2446704	hsa-miR-4673	CLIP-seq
MIRT2446705	hsa-miR-4692	CLIP-seq
MIRT2446706	hsa-miR-4726-5p	CLIP-seq
MIRT2446707	hsa-miR-4749-3p	CLIP-seq
MIRT2446708	hsa-miR-4755-3p	CLIP-seq
MIRT881236	hsa-miR-323b-3p	CLIP-seq
MIRT881195	hsa-miR-1224-3p	CLIP-seq
MIRT881196	hsa-miR-1236	CLIP-seq
MIRT2501037	hsa-miR-1260	CLIP-seq
MIRT2501038	hsa-miR-1260b	CLIP-seq
MIRT2501039	hsa-miR-1280	CLIP-seq
MIRT2501040	hsa-miR-1323	CLIP-seq
MIRT2501041	hsa-miR-186	CLIP-seq
MIRT2501042	hsa-miR-217	CLIP-seq
MIRT881225	hsa-miR-3074-3p	CLIP-seq
MIRT2501043	hsa-miR-3688-3p	CLIP-seq
MIRT2501044	hsa-miR-3978	CLIP-seq
MIRT2501045	hsa-miR-4317	CLIP-seq
MIRT2501046	hsa-miR-4469	CLIP-seq
MIRT2501047	hsa-miR-4715-3p	CLIP-seq
MIRT2501048	hsa-miR-4725-5p	CLIP-seq
MIRT2501049	hsa-miR-4733-3p	CLIP-seq
MIRT2501050	hsa-miR-504	CLIP-seq
MIRT2501051	hsa-miR-532-3p	CLIP-seq
MIRT2501052	hsa-miR-548o	CLIP-seq
MIRT2501053	hsa-miR-642a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Activation	15289351
JUN	Unknown	22550165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	7592934
GO:0000226	Process	Microtubule cytoskeleton organization	TAS	17491008
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IPI	16039528
GO:0001764	Process	Neuron migration	IEA
GO:0001764	Process	Neuron migration	ISS
GO:0002020	Function	Protease binding	IEA
GO:0003779	Function	Actin binding	IEA
GO:0004672	Function	Protein kinase activity	TAS	7592934
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	8090221, 10721722, 12223541, 14521924, 15689152, 20133653, 21220307, 23543736, 23602568, 25416956, 28514442, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007158	Process	Neuron cell-cell adhesion	IEA
GO:0007158	Process	Neuron cell-cell adhesion	ISS
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	ISS
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007413	Process	Axonal fasciculation	ISS
GO:0007420	Process	Brain development	IBA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0007420	Process	Brain development	NAS	10915792
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016241	Process	Regulation of macroautophagy	NAS	21499257
GO:0016301	Function	Kinase activity	ISS
GO:0016533	Component	Protein kinase 5 complex	IEA
GO:0016533	Component	Protein kinase 5 complex	IPI	15689152
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	12832520
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	12832520
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	12832520
GO:0021549	Process	Cerebellum development	IEA
GO:0021722	Process	Superior olivary nucleus maturation	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021799	Process	Cerebral cortex radially oriented cell migration	IEA
GO:0021819	Process	Layer formation in cerebral cortex	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030295	Function	Protein kinase activator activity	TAS	8090221
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	IBA
GO:0030426	Component	Growth cone	ISS
GO:0031116	Process	Positive regulation of microtubule polymerization	ISS
GO:0031175	Process	Neuron projection development	ISS
GO:0031175	Process	Neuron projection development	TAS	17491008
GO:0031594	Component	Neuromuscular junction	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043197	Component	Dendritic spine	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043292	Component	Contractile muscle fiber	ISS
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	12832520
GO:0043539	Function	Protein serine/threonine kinase activator activity	ISS
GO:0045296	Function	Cadherin binding	ISS
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IDA	29020624
GO:0045664	Process	Regulation of neuron differentiation	NAS	10721722
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20357208
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12832520
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048487	Function	Beta-tubulin binding	ISS
GO:0048487	Function	Beta-tubulin binding	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:0061001	Process	Regulation of dendritic spine morphogenesis	IEA
GO:0061001	Process	Regulation of dendritic spine morphogenesis	ISS
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IBA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IGI	17517623
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	17491008
GO:0070315	Process	G1 to G0 transition involved in cell differentiation	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IDA	29020624

Other IDs

• MIM: 603460
• HGNC: 1775
• e!Ensembl: ENSG00000176749

Protein

• UniProt ID: Q15078
• Protein name: Cyclin-dependent kinase 5 activator 1 (CDK5 activator 1) (Cyclin-dependent kinase 5 regulatory subunit 1) (TPKII regulatory subunit) [Cleaved into: Cyclin-dependent kinase 5 activator 1, p35 (p35); Cyclin-dependent kinase 5 activator 1, p25 (p25) (Tau pro
• Protein function: p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK
• PDB: 1H4L, 1UNG, 1UNH, 1UNL, 3O0G, 6LDP, 7CNG, 7VDP, 7VDQ, 7VDR, 7VDS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03261	CDK5_activator	106 → 295	Cyclin-dependent kinase 5 activator protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Brain and neuron specific.
• Sequence:

  MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
  KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
  GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
  VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
  ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
  LLLGLDR

• Sequence length: 307

Pathways

KEGG:

Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Cocaine addiction

Reactome:

CRMPs in Sema3A signaling
Regulation of TP53 Activity through Phosphorylation
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
NGF-stimulated transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CDK5R1-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27880046		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	2895757		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12230554, 12826674, 20513426, 27343180, 28578378, 29027727, 29997370	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12860412	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36561735	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28912154		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12657672, 22262900, 28444573, 29602913		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	25241147		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11228158		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18205865		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20847343, 22074947, 22677230, 24106833		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22696682, 37899376	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	22696682	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33346796	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22696682		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21825040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20603238		★☆☆☆☆ Found in Text Mining only
Cerebral cortex myoclonus	Cerebral Cortex Myoclonus	BEFREE	31401489		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17493033, 30158515		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22677230		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	11444477		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	17581637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	18053171, 21544067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8824727		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11118734, 9502407		★☆☆☆☆ Found in Text Mining only
Developmental reading disorder	Developmental dyslexia	BEFREE	19277710		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10593565, 12496451		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28640256		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	CTD_human_DG	15665076		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12377406		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	26490183		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14621192, 28912154		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	3313005		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	18075258		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28392472		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	28444573		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	15175076		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	LHGDN	15175076		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	29731755		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18588867		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11296485	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29130599		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28391013		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31715265		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24098701	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24994465		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8656012		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21544067, 24725413		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	16425041, 18053171, 26469698, 26657932		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	LHGDN	16425041		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	18053171	Associate	★☆☆☆☆ Found in Text Mining only
Isodicentric Chromosome 15 Syndrome	Isodicentric Chromosome 15 Syndrome	BEFREE	12673638		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11389014	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12034535, 8500100		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	2895757		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22696682	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10525320, 11014347, 12472178		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12153001		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12153001		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12153001		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20847343, 22074947, 22677230, 24106833		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22696682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20603238		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21825040, 31472403		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12377406, 15123618, 22899854, 25241147		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20181942, 20603238, 23355466, 30204910, 31257629		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16809759, 20847343		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17145757		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	16425041, 18053171, 26469698		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15009685		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11358987, 12377406, 12460909, 15949565, 16763609, 16809759, 16823838, 20603238, 22074947, 24106833, 28640256, 29782920		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21338355		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15485494		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15485494, 21625387	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	12230554, 18053171, 27343180	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	14642273, 15307952, 17979810, 18053171, 21691801, 21844361, 22262900, 24725413, 26657932, 27258419, 28085018, 28392472, 29910724, 31073393		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	16525053		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	21616478		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20181942		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20181942	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20603238		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21825040, 31472403		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21825040	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	11118734		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21130530, 22262900, 29471019, 29910724		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18588867		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12377406, 15123618, 22899854, 25241147		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15123618		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29802736		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8824727		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23900261		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31317786, 31788758		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25697137		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37899376	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21772061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21772061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	25878277		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31760199		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17493033	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29535807		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	22612807		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Unverricht-Lundborg Syndrome	Myoclonic Epilepsy	BEFREE	25023721		★☆☆☆☆ Found in Text Mining only
X-Linked Lissencephaly	Lissencephaly, X-Linked	BEFREE	10826984		★☆☆☆☆ Found in Text Mining only