KAT2B (lysine acetyltransferase 2B)

Gene

• Entrez ID: 8850
• Gene name: Lysine acetyltransferase 2B
• Gene symbol: KAT2B
• Synonyms (NCBI Gene): CAF, P/CAF, PCAF
• Chromosome: 3
• Chromosome location: 3p24.3
• Summary: CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004327	hsa-miR-181a-5p	Western blot, Luciferase reporter assay	18728182
MIRT004328	hsa-miR-181b-5p	Western blot, Luciferase reporter assay	18728182
MIRT004329	hsa-miR-25-3p	Western blot, Luciferase reporter assay	18728182
MIRT004330	hsa-miR-32-5p	Western blot, Luciferase reporter assay	18728182
MIRT004331	hsa-miR-92a-3p	Western blot, Luciferase reporter assay	18728182
MIRT004332	hsa-miR-93-5p	Western blot, Luciferase reporter assay	18728182
MIRT004333	hsa-miR-106b-5p	Western blot, Luciferase reporter assay	18728182
MIRT004334	hsa-miR-19a-3p	Western blot, Luciferase reporter assay	18728182
MIRT004335	hsa-miR-19b-3p	Western blot, Luciferase reporter assay	18728182
MIRT004333	hsa-miR-106b-5p	Luciferase reporter assay	18728182
MIRT004327	hsa-miR-181a-5p	Luciferase reporter assay	18728182
MIRT004328	hsa-miR-181b-5p	Luciferase reporter assay	18728182
MIRT004329	hsa-miR-25-3p	Luciferase reporter assay	18728182
MIRT004330	hsa-miR-32-5p	Luciferase reporter assay	18728182
MIRT004332	hsa-miR-93-5p	Luciferase reporter assay	18728182
MIRT004333	hsa-miR-106b-5p	Microarray	17242205
MIRT024568	hsa-miR-215-5p	Microarray	19074876
MIRT026230	hsa-miR-192-5p	Microarray	19074876
MIRT029198	hsa-miR-26b-5p	Microarray	19088304
MIRT054344	hsa-miR-17-5p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23095762
MIRT209673	hsa-miR-142-3p	Microarray, qRT-PCR	22815788
MIRT440411	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440412	hsa-miR-539-5p	HITS-CLIP	24374217
MIRT440411	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440412	hsa-miR-539-5p	HITS-CLIP	24374217
MIRT004331	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT162309	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT004330	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1078618	hsa-miR-106a	CLIP-seq
MIRT1078619	hsa-miR-106b	CLIP-seq
MIRT1078620	hsa-miR-1207-3p	CLIP-seq
MIRT1078621	hsa-miR-1226	CLIP-seq
MIRT1078622	hsa-miR-1305	CLIP-seq
MIRT1078623	hsa-miR-137	CLIP-seq
MIRT1078624	hsa-miR-17	CLIP-seq
MIRT1078625	hsa-miR-197	CLIP-seq
MIRT1078626	hsa-miR-200b	CLIP-seq
MIRT1078627	hsa-miR-200c	CLIP-seq
MIRT1078628	hsa-miR-20a	CLIP-seq
MIRT1078629	hsa-miR-20b	CLIP-seq
MIRT1078630	hsa-miR-2277-3p	CLIP-seq
MIRT1078631	hsa-miR-2355-3p	CLIP-seq
MIRT1078632	hsa-miR-25	CLIP-seq
MIRT1078633	hsa-miR-302a	CLIP-seq
MIRT1078634	hsa-miR-302b	CLIP-seq
MIRT1078635	hsa-miR-302c	CLIP-seq
MIRT1078636	hsa-miR-302d	CLIP-seq
MIRT1078637	hsa-miR-302e	CLIP-seq
MIRT1078638	hsa-miR-3120-3p	CLIP-seq
MIRT1078639	hsa-miR-32	CLIP-seq
MIRT1078640	hsa-miR-330-3p	CLIP-seq
MIRT1078641	hsa-miR-338-5p	CLIP-seq
MIRT1078642	hsa-miR-363	CLIP-seq
MIRT1078643	hsa-miR-3660	CLIP-seq
MIRT1078644	hsa-miR-367	CLIP-seq
MIRT1078645	hsa-miR-372	CLIP-seq
MIRT1078646	hsa-miR-373	CLIP-seq
MIRT1078647	hsa-miR-3942-3p	CLIP-seq
MIRT1078648	hsa-miR-429	CLIP-seq
MIRT1078649	hsa-miR-4302	CLIP-seq
MIRT1078650	hsa-miR-433	CLIP-seq
MIRT1078651	hsa-miR-4422	CLIP-seq
MIRT1078652	hsa-miR-450b-5p	CLIP-seq
MIRT1078653	hsa-miR-452	CLIP-seq
MIRT1078654	hsa-miR-4526	CLIP-seq
MIRT1078655	hsa-miR-4646-3p	CLIP-seq
MIRT1078656	hsa-miR-4676-3p	CLIP-seq
MIRT1078657	hsa-miR-4694-5p	CLIP-seq
MIRT1078658	hsa-miR-4733-3p	CLIP-seq
MIRT1078659	hsa-miR-518a-5p	CLIP-seq
MIRT1078660	hsa-miR-519d	CLIP-seq
MIRT1078661	hsa-miR-520a-3p	CLIP-seq
MIRT1078662	hsa-miR-520b	CLIP-seq
MIRT1078663	hsa-miR-520c-3p	CLIP-seq
MIRT1078664	hsa-miR-520d-3p	CLIP-seq
MIRT1078665	hsa-miR-520d-5p	CLIP-seq
MIRT1078666	hsa-miR-520e	CLIP-seq
MIRT1078667	hsa-miR-524-5p	CLIP-seq
MIRT1078668	hsa-miR-527	CLIP-seq
MIRT1078669	hsa-miR-545	CLIP-seq
MIRT1078670	hsa-miR-548aa	CLIP-seq
MIRT1078671	hsa-miR-548ac	CLIP-seq
MIRT1078672	hsa-miR-548c-3p	CLIP-seq
MIRT1078673	hsa-miR-548d-3p	CLIP-seq
MIRT1078674	hsa-miR-548t	CLIP-seq
MIRT1078675	hsa-miR-548z	CLIP-seq
MIRT1078676	hsa-miR-556-3p	CLIP-seq
MIRT1078677	hsa-miR-591	CLIP-seq
MIRT1078678	hsa-miR-607	CLIP-seq
MIRT1078679	hsa-miR-609	CLIP-seq
MIRT1078680	hsa-miR-664	CLIP-seq
MIRT1078681	hsa-miR-676	CLIP-seq
MIRT1078682	hsa-miR-767-3p	CLIP-seq
MIRT1078683	hsa-miR-92a	CLIP-seq
MIRT1078684	hsa-miR-92b	CLIP-seq
MIRT1078685	hsa-miR-93	CLIP-seq
MIRT1078686	hsa-miR-944	CLIP-seq
MIRT1078618	hsa-miR-106a	CLIP-seq
MIRT1078619	hsa-miR-106b	CLIP-seq
MIRT2019590	hsa-miR-1206	CLIP-seq
MIRT2019591	hsa-miR-1236	CLIP-seq
MIRT2019592	hsa-miR-1276	CLIP-seq
MIRT2019593	hsa-miR-142-5p	CLIP-seq
MIRT1078624	hsa-miR-17	CLIP-seq
MIRT1078628	hsa-miR-20a	CLIP-seq
MIRT1078629	hsa-miR-20b	CLIP-seq
MIRT1078633	hsa-miR-302a	CLIP-seq
MIRT1078634	hsa-miR-302b	CLIP-seq
MIRT1078635	hsa-miR-302c	CLIP-seq
MIRT1078636	hsa-miR-302d	CLIP-seq
MIRT1078637	hsa-miR-302e	CLIP-seq
MIRT2019594	hsa-miR-3133	CLIP-seq
MIRT2019595	hsa-miR-323b-5p	CLIP-seq
MIRT2019596	hsa-miR-340	CLIP-seq
MIRT1078645	hsa-miR-372	CLIP-seq
MIRT1078646	hsa-miR-373	CLIP-seq
MIRT2019597	hsa-miR-376a	CLIP-seq
MIRT2019598	hsa-miR-376b	CLIP-seq
MIRT2019599	hsa-miR-4311	CLIP-seq
MIRT2019600	hsa-miR-4775	CLIP-seq
MIRT2019601	hsa-miR-4796-5p	CLIP-seq
MIRT2019602	hsa-miR-487a	CLIP-seq
MIRT2019603	hsa-miR-499-3p	CLIP-seq
MIRT2019604	hsa-miR-499a-3p	CLIP-seq
MIRT1078660	hsa-miR-519d	CLIP-seq
MIRT1078661	hsa-miR-520a-3p	CLIP-seq
MIRT1078662	hsa-miR-520b	CLIP-seq
MIRT1078663	hsa-miR-520c-3p	CLIP-seq
MIRT1078664	hsa-miR-520d-3p	CLIP-seq
MIRT1078666	hsa-miR-520e	CLIP-seq
MIRT2019605	hsa-miR-548b-3p	CLIP-seq
MIRT1078674	hsa-miR-548t	CLIP-seq
MIRT1078676	hsa-miR-556-3p	CLIP-seq
MIRT2019606	hsa-miR-568	CLIP-seq
MIRT2019607	hsa-miR-579	CLIP-seq
MIRT2019608	hsa-miR-583	CLIP-seq
MIRT2019609	hsa-miR-584	CLIP-seq
MIRT1078685	hsa-miR-93	CLIP-seq
MIRT1078686	hsa-miR-944	CLIP-seq
MIRT2019590	hsa-miR-1206	CLIP-seq
MIRT1078623	hsa-miR-137	CLIP-seq
MIRT1078632	hsa-miR-25	CLIP-seq
MIRT1078639	hsa-miR-32	CLIP-seq
MIRT1078641	hsa-miR-338-5p	CLIP-seq
MIRT1078642	hsa-miR-363	CLIP-seq
MIRT1078644	hsa-miR-367	CLIP-seq
MIRT1078650	hsa-miR-433	CLIP-seq
MIRT2019603	hsa-miR-499-3p	CLIP-seq
MIRT2019604	hsa-miR-499a-3p	CLIP-seq
MIRT2019607	hsa-miR-579	CLIP-seq
MIRT1078677	hsa-miR-591	CLIP-seq
MIRT1078680	hsa-miR-664	CLIP-seq
MIRT1078683	hsa-miR-92a	CLIP-seq
MIRT1078684	hsa-miR-92b	CLIP-seq
MIRT2442281	hsa-miR-1343	CLIP-seq
MIRT2442282	hsa-miR-3074-5p	CLIP-seq
MIRT2442283	hsa-miR-3124-3p	CLIP-seq
MIRT2442284	hsa-miR-3160-5p	CLIP-seq
MIRT1078640	hsa-miR-330-3p	CLIP-seq
MIRT2442285	hsa-miR-3690	CLIP-seq
MIRT2442286	hsa-miR-4254	CLIP-seq
MIRT1078620	hsa-miR-1207-3p	CLIP-seq
MIRT2554742	hsa-miR-1208	CLIP-seq
MIRT2554743	hsa-miR-1297	CLIP-seq
MIRT1078622	hsa-miR-1305	CLIP-seq
MIRT2554744	hsa-miR-185	CLIP-seq
MIRT2554745	hsa-miR-188-5p	CLIP-seq
MIRT2554746	hsa-miR-205	CLIP-seq
MIRT2554747	hsa-miR-214	CLIP-seq
MIRT2554748	hsa-miR-216a	CLIP-seq
MIRT1078630	hsa-miR-2277-3p	CLIP-seq
MIRT2554749	hsa-miR-26a	CLIP-seq
MIRT2554750	hsa-miR-26b	CLIP-seq
MIRT2554751	hsa-miR-27a	CLIP-seq
MIRT2554752	hsa-miR-27b	CLIP-seq
MIRT1078638	hsa-miR-3120-3p	CLIP-seq
MIRT2554753	hsa-miR-3126-3p	CLIP-seq
MIRT2019595	hsa-miR-323b-5p	CLIP-seq
MIRT1078640	hsa-miR-330-3p	CLIP-seq
MIRT2554754	hsa-miR-337-3p	CLIP-seq
MIRT2554755	hsa-miR-3607-5p	CLIP-seq
MIRT2554756	hsa-miR-3619-5p	CLIP-seq
MIRT2554757	hsa-miR-3667-3p	CLIP-seq
MIRT2554758	hsa-miR-3685	CLIP-seq
MIRT2554759	hsa-miR-3713	CLIP-seq
MIRT2554760	hsa-miR-384	CLIP-seq
MIRT2554761	hsa-miR-3977	CLIP-seq
MIRT2554762	hsa-miR-4280	CLIP-seq
MIRT2554763	hsa-miR-4291	CLIP-seq
MIRT2554764	hsa-miR-4306	CLIP-seq
MIRT1078651	hsa-miR-4422	CLIP-seq
MIRT2554765	hsa-miR-4426	CLIP-seq
MIRT2554766	hsa-miR-4456	CLIP-seq
MIRT2554767	hsa-miR-4465	CLIP-seq
MIRT1078653	hsa-miR-452	CLIP-seq
MIRT2554768	hsa-miR-4520a-3p	CLIP-seq
MIRT2554769	hsa-miR-455-3p	CLIP-seq
MIRT2554770	hsa-miR-4638-3p	CLIP-seq
MIRT2554771	hsa-miR-4644	CLIP-seq
MIRT2554772	hsa-miR-4647	CLIP-seq
MIRT2554773	hsa-miR-4662b	CLIP-seq
MIRT1078656	hsa-miR-4676-3p	CLIP-seq
MIRT2554774	hsa-miR-4729	CLIP-seq
MIRT2554775	hsa-miR-4733-5p	CLIP-seq
MIRT2019600	hsa-miR-4775	CLIP-seq
MIRT2554776	hsa-miR-4777-3p	CLIP-seq
MIRT2554777	hsa-miR-4786-5p	CLIP-seq
MIRT2554778	hsa-miR-491-3p	CLIP-seq
MIRT2554779	hsa-miR-498	CLIP-seq
MIRT2554780	hsa-miR-513a-5p	CLIP-seq
MIRT2554781	hsa-miR-516b	CLIP-seq
MIRT1078665	hsa-miR-520d-5p	CLIP-seq
MIRT1078667	hsa-miR-524-5p	CLIP-seq
MIRT2554782	hsa-miR-541	CLIP-seq
MIRT1078669	hsa-miR-545	CLIP-seq
MIRT1078670	hsa-miR-548aa	CLIP-seq
MIRT2554783	hsa-miR-548g	CLIP-seq
MIRT2019606	hsa-miR-568	CLIP-seq
MIRT2019607	hsa-miR-579	CLIP-seq
MIRT2019609	hsa-miR-584	CLIP-seq
MIRT2554784	hsa-miR-605	CLIP-seq
MIRT2554785	hsa-miR-634	CLIP-seq
MIRT2554786	hsa-miR-654-5p	CLIP-seq
MIRT2554787	hsa-miR-656	CLIP-seq
MIRT2554788	hsa-miR-761	CLIP-seq
MIRT2554789	hsa-miR-769-5p	CLIP-seq
MIRT2554790	hsa-miR-873	CLIP-seq
MIRT2554791	hsa-miR-922	CLIP-seq
MIRT2554775	hsa-miR-4733-5p	CLIP-seq
MIRT2554783	hsa-miR-548g	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18838386
GO:0000123	Component	Histone acetyltransferase complex	IEA
GO:0000124	Component	SAGA complex	NAS	9674425, 17707232, 19114550
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0000776	Component	Kinetochore	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003712	Function	Transcription coregulator activity	IPI	8684459
GO:0003713	Function	Transcription coactivator activity	IDA	12435739, 14645221
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0004145	Function	Diamine N-acetyltransferase activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	EXP	23555303
GO:0004402	Function	Histone acetyltransferase activity	IDA	14645221
GO:0004402	Function	Histone acetyltransferase activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	IMP	16829519
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	19303849, 19470756, 23932781
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IEA
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	ISS
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	8684459, 9674425, 9687513, 11568182, 12435739, 12743606, 12813456, 12887892, 14645221, 15273251, 16322561, 16332960, 16415179, 16543236, 16617118, 17301242, 18504427, 19188449, 19303849, 19407811, 22575646, 23932781, 24492005, 24825348, 26867678, 27796307, 29174768, 32814053, 338944
GO:0005634	Component	Nucleus	IDA	25593309, 27796307
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	10891508
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	39881208
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	27796307
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006282	Process	Regulation of DNA repair	NAS	11564863
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	17707232
GO:0006338	Process	Chromatin remodeling	NAS	10365964
GO:0006338	Process	Chromatin remodeling	TAS	8684459
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006473	Process	Protein acetylation	IDA	15273251, 26867678
GO:0006473	Process	Protein acetylation	TAS	8684459
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	23932781
GO:0006633	Process	Fatty acid biosynthetic process	IDA	10653665, 19286649
GO:0007507	Process	Heart development	ISS
GO:0007613	Process	Memory	IEA
GO:0008047	Function	Enzyme activator activity	IDA	19470756
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	8684459
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010484	Function	Histone H3 acetyltransferase activity	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016407	Function	Acetyltransferase activity	IDA	8684459, 15273251, 17301242
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0018076	Process	N-terminal peptidyl-lysine acetylation	IDA	12435739
GO:0018393	Process	Internal peptidyl-lysine acetylation	IDA	23932781, 27796307, 29174768
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0031672	Component	A band	IEA
GO:0031674	Component	I band	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0032991	Component	Protein-containing complex	IDA	15273251
GO:0032991	Component	Protein-containing complex	IPI	17707232
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042641	Component	Actomyosin	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	12887892
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0043992	Function	Histone H3K9 acetyltransferase activity	IDA	21131905
GO:0043992	Function	Histone H3K9 acetyltransferase activity	IEA
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IDA	23932781
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	TAS
GO:0045821	Process	Positive regulation of glycolytic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19470756
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0046600	Process	Negative regulation of centriole replication	IDA	27796307
GO:0046600	Process	Negative regulation of centriole replication	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051302	Process	Regulation of cell division	ISS
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	23001180
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0051726	Process	Regulation of cell cycle	TAS	8684459
GO:0060173	Process	Limb development	ISS
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IDA	23001180, 23932781, 26867678, 27796307, 29174768
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	TAS
GO:0062012	Process	Regulation of small molecule metabolic process	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0072686	Component	Mitotic spindle	NAS	20562830
GO:0110076	Process	Negative regulation of ferroptosis	IDA	35922516
GO:0110076	Process	Negative regulation of ferroptosis	IMP	31634899
GO:0110076	Process	Negative regulation of ferroptosis	IMP	39881208
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15509593, 17301242, 17505058
GO:0140672	Component	ATAC complex	IBA
GO:0140672	Component	ATAC complex	IDA	18838386
GO:0140672	Component	ATAC complex	IEA
GO:0140672	Component	ATAC complex	ISO
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	IDA	23001180
GO:2000233	Process	Negative regulation of rRNA processing	IDA	26867678

Other IDs

• MIM: 602303
• HGNC: 8638
• e!Ensembl: ENSG00000114166

Protein

• UniProt ID: Q92831
• Protein name: Histone acetyltransferase KAT2B (EC 2.3.1.48) (Histone acetyltransferase PCAF) (Histone acetylase PCAF) (Lysine acetyltransferase 2B) (P300/CBP-associated factor) (P/CAF) (Spermidine acetyltransferase KAT2B) (EC 2.3.1.57)
• Protein function: Functions as a histone acetyltransferase (HAT) to promote transcriptional activation (PubMed:8945521). Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles (PubMed:8945521). H
• PDB: 1CM0, 1JM4, 1N72, 1WUG, 1WUM, 1ZS5, 2RNW, 2RNX, 3GG3, 4NSQ, 5FDZ, 5FE0, 5FE1, 5FE2, 5FE3, 5FE4, 5FE5, 5FE6, 5FE7, 5FE8, 5FE9, 5LVQ, 5LVR, 5MKX, 6J3O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06466	PCAF_N	74 → 326	PCAF (P300/CBP-associated factor) N-terminal domain	Domain
  PF00583	Acetyltransf_1	514 → 622	Acetyltransferase (GNAT) family	Family
  PF00439	Bromodomain	732 → 815	Bromodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed but most abundant in heart and skeletal muscle. Also expressed in the skin, in keratinocytes (at protein level) (PubMed:20940255). {ECO:0000269|PubMed:20940255, ECO:0000269|PubMed:8684459}.
• Sequence:

  MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
  AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
  PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
  ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
  RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
  YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
  NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
  LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
  RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
  PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
  DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
  VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
  EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
  YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

• Sequence length: 832

Pathways

KEGG:

Viral life cycle - HIV-1
Notch signaling pathway
Thyroid hormone signaling pathway
Human T-cell leukemia virus 1 infection
Viral carcinogenesis

Reactome:

Pre-NOTCH Transcription and Translation
YAP1- and WWTR1 (TAZ)-stimulated gene expression
NOTCH1 Intracellular Domain Regulates Transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway
B-WICH complex positively regulates rRNA expression
Physiological factors
Metalloprotease DUBs
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
RUNX3 regulates NOTCH signaling
NOTCH3 Intracellular Domain Regulates Transcription
NOTCH4 Intracellular Domain Regulates Transcription
Estrogen-dependent gene expression
Regulation of FOXO transcriptional activity by acetylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KAT2B-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25800736, 27613418, 29301498		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23943798		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	26767057	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26767057		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	10807475, 11444929		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36810794	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	31575856	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31003455		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	17725108		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30744595		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	38072145	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18458534, 22954256, 22995475, 28637482, 30395269, 30756331		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15153330, 27881889, 37117180	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	20410122		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	29555579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25855960	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27350734, 31828297, 34173348	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26152796, 30744595		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29301498		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23696899, 36849201	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29555579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29041931		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29768408		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32239175	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	17725108		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23943798		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28751935	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18987336, 24052018, 28158851, 28418886		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31042625		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26662507		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21062767		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31735552		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25497092, 29228881		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25497092, 29121716, 29228881		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11296231, 26634513	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16206511		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37887281	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	29908751		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30367467, 30463848		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30367467, 30463848		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28518141, 34555274	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	36849201	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingival Recession	Gingival Recession	BEFREE	29873085, 30099762, 30293186		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10896202, 23943798, 25501279, 25712375		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25501279, 25712375	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23943798, 25501279, 25712375		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25712375	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	32239175	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29768408		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	25855960		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25497092		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25025381	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26802082		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25496441		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	25025381	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28053092	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	28053092	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	18599479		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22709982, 25855960, 27350734		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29301498, 31908099, 31908141	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25611806	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21385555		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21854747	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34130593	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34631879	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18458534, 22954256, 22995475, 28637482, 30395269, 30756331		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30367467, 30463848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26398776, 31642074		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29301498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29041931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23661605, 30833716		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26152796, 30744595		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12402157, 17725108, 19470942, 20491776, 22709982, 23591450, 23943798, 24039846, 26893143, 27425378, 27488962, 29228881, 29344235, 29671337, 30044210, 30118769, 30254333, 31505876, 31545241, 9288775		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18987336, 24052018, 28158851, 28418886		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15153330, 22199269, 30871158		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23943798		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29555579	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25497092		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29908751		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	20371377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25025381	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29685955, 32083569	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10896202, 17725108, 18987336, 19470942, 19525977, 20589832, 21112238, 21804603, 23343772, 25593028, 25855960, 27128408, 27425378, 28178651, 28418886, 29506142, 30463848, 30683902, 31749406, 9288775		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27425378		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36894612	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28132653, 29500370		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29500370	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19479829	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27300495		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38072145	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31545241		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31545241	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29041931		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30678426, 37828084	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36200682, 36849201	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	32549759, 33589694	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	10807475		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27177087		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	15327388	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Recessive	Polycystic kidney disease	Pubtator	15327388	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23661605, 30833716		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23095762, 24294372	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30833716	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30925687		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37603355	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	17468105		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	17468105	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20213728		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30738099		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19525977, 29029429, 30463848		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36148955	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31604589		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	29768408		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21854747, 26168960	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24668547, 29670108	Inhibit	★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	25025381	Inhibit	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28678170		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34130593	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	25593028	Associate	★☆☆☆☆ Found in Text Mining only