Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8834
Gene name	Transmembrane protein 11
Gene symbol	TMEM11
Synonyms (NCBI Gene)	C17orf35PM1PMI
Chromosome	17
Chromosome location	17p11.2

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045019	hsa-miR-186-5p	CLASH	23622248
MIRT712121	hsa-miR-544b	HITS-CLIP	19536157
MIRT712120	hsa-miR-20a-3p	HITS-CLIP	19536157
MIRT712119	hsa-miR-3184-5p	HITS-CLIP	19536157
MIRT712118	hsa-miR-423-5p	HITS-CLIP	19536157
MIRT712117	hsa-miR-1914-3p	HITS-CLIP	19536157
MIRT712116	hsa-miR-5194	HITS-CLIP	19536157
MIRT712115	hsa-miR-6738-5p	HITS-CLIP	19536157
MIRT712114	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT712113	hsa-miR-6734-5p	HITS-CLIP	19536157
MIRT712121	hsa-miR-544b	HITS-CLIP	19536157
MIRT712120	hsa-miR-20a-3p	HITS-CLIP	19536157
MIRT712119	hsa-miR-3184-5p	HITS-CLIP	19536157
MIRT712118	hsa-miR-423-5p	HITS-CLIP	19536157
MIRT712117	hsa-miR-1914-3p	HITS-CLIP	19536157
MIRT712116	hsa-miR-5194	HITS-CLIP	19536157
MIRT712115	hsa-miR-6738-5p	HITS-CLIP	19536157
MIRT712114	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT712113	hsa-miR-6734-5p	HITS-CLIP	19536157
MIRT520674	hsa-miR-7112-5p	PAR-CLIP	23446348
MIRT520673	hsa-miR-6089	PAR-CLIP	23446348
MIRT520672	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT520671	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT520670	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT520669	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT520668	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT520667	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT520666	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT520665	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT520664	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT520663	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT520662	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT520661	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT520660	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT520659	hsa-miR-3689c	PAR-CLIP	23446348
MIRT520658	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT520657	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT520656	hsa-miR-450a-1-3p	PAR-CLIP	23446348
MIRT520655	hsa-miR-3122	PAR-CLIP	23446348
MIRT520654	hsa-miR-3913-5p	PAR-CLIP	23446348
MIRT520653	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT520652	hsa-miR-6513-5p	PAR-CLIP	23446348
MIRT712121	hsa-miR-544b	HITS-CLIP	19536157
MIRT712120	hsa-miR-20a-3p	HITS-CLIP	19536157
MIRT712119	hsa-miR-3184-5p	HITS-CLIP	19536157
MIRT712118	hsa-miR-423-5p	HITS-CLIP	19536157
MIRT712117	hsa-miR-1914-3p	HITS-CLIP	19536157
MIRT712116	hsa-miR-5194	HITS-CLIP	19536157
MIRT712115	hsa-miR-6738-5p	HITS-CLIP	19536157
MIRT712114	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT712113	hsa-miR-6734-5p	HITS-CLIP	19536157
MIRT712121	hsa-miR-544b	HITS-CLIP	19536157
MIRT712120	hsa-miR-20a-3p	HITS-CLIP	19536157
MIRT712119	hsa-miR-3184-5p	HITS-CLIP	19536157
MIRT712118	hsa-miR-423-5p	HITS-CLIP	19536157
MIRT712117	hsa-miR-1914-3p	HITS-CLIP	19536157
MIRT712116	hsa-miR-5194	HITS-CLIP	19536157
MIRT712115	hsa-miR-6738-5p	HITS-CLIP	19536157
MIRT712114	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT712113	hsa-miR-6734-5p	HITS-CLIP	19536157
MIRT520674	hsa-miR-7112-5p	PAR-CLIP	23446348
MIRT520673	hsa-miR-6089	PAR-CLIP	23446348
MIRT520672	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT520671	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT520670	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT520669	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT520668	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT520667	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT520666	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT520665	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT520664	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT520663	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT520662	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT520661	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT520660	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT520659	hsa-miR-3689c	PAR-CLIP	23446348
MIRT520658	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT520657	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT520656	hsa-miR-450a-1-3p	PAR-CLIP	23446348
MIRT520655	hsa-miR-3122	PAR-CLIP	23446348
MIRT520654	hsa-miR-3913-5p	PAR-CLIP	23446348
MIRT520653	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT520652	hsa-miR-6513-5p	PAR-CLIP	23446348
MIRT2466241	hsa-miR-1179	CLIP-seq
MIRT2466242	hsa-miR-4310	CLIP-seq
MIRT2466243	hsa-miR-4436b-5p	CLIP-seq
MIRT2643951	hsa-miR-1225-5p	CLIP-seq
MIRT2643952	hsa-miR-3160-3p	CLIP-seq
MIRT2643953	hsa-miR-3591-5p	CLIP-seq
MIRT2643954	hsa-miR-3688-3p	CLIP-seq
MIRT2643955	hsa-miR-3692	CLIP-seq
MIRT2643956	hsa-miR-3940-5p	CLIP-seq
MIRT2643957	hsa-miR-4280	CLIP-seq
MIRT2643958	hsa-miR-4292	CLIP-seq
MIRT2643959	hsa-miR-4487	CLIP-seq
MIRT2643960	hsa-miR-4507	CLIP-seq
MIRT2643961	hsa-miR-495	CLIP-seq
MIRT2643962	hsa-miR-548ac	CLIP-seq
MIRT2643963	hsa-miR-548c-3p	CLIP-seq
MIRT2643964	hsa-miR-548d-3p	CLIP-seq
MIRT2643965	hsa-miR-548z	CLIP-seq
MIRT2643966	hsa-miR-556-5p	CLIP-seq
MIRT2643967	hsa-miR-558	CLIP-seq
MIRT2643968	hsa-miR-635	CLIP-seq
MIRT2643951	hsa-miR-1225-5p	CLIP-seq
MIRT2643952	hsa-miR-3160-3p	CLIP-seq
MIRT2643953	hsa-miR-3591-5p	CLIP-seq
MIRT2643954	hsa-miR-3688-3p	CLIP-seq
MIRT2643955	hsa-miR-3692	CLIP-seq
MIRT2643956	hsa-miR-3940-5p	CLIP-seq
MIRT2643957	hsa-miR-4280	CLIP-seq
MIRT2643958	hsa-miR-4292	CLIP-seq
MIRT2643959	hsa-miR-4487	CLIP-seq
MIRT2643960	hsa-miR-4507	CLIP-seq
MIRT2643961	hsa-miR-495	CLIP-seq
MIRT2643962	hsa-miR-548ac	CLIP-seq
MIRT2643963	hsa-miR-548c-3p	CLIP-seq
MIRT2643964	hsa-miR-548d-3p	CLIP-seq
MIRT2643965	hsa-miR-548z	CLIP-seq
MIRT2643966	hsa-miR-556-5p	CLIP-seq
MIRT2643967	hsa-miR-558	CLIP-seq
MIRT2643968	hsa-miR-635	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 25416956, 27107012, 28514442, 32296183, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	21274005
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	2110658
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	21274005
GO:0007007	Process	Inner mitochondrial membrane organization	IBA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
618817	16823	ENSG00000178307

P17152

Protein name

Transmembrane protein 11, mitochondrial (Protein PM1) (Protein PMI)

Protein function

Plays a role in mitochondrial morphogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14972	Mito_morph_reg	28 → 190	Mitochondrial morphogenesis regulator	Family

Sequence

MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYI
VIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCT
LYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALV
YCVKKIYELYAV

Sequence length

192

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	29861834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29861834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20705404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	31060956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1B	Congenital disorder of glycosylation	BEFREE	11134235, 21949237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1B	Congenital disorder of glycosylation	Pubtator	11567948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18555856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	BEFREE	30987467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	24521217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28528304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29571049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23848581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7906417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29925051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14506695, 20395201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27712141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28528304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	29861834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31751587		★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM11 (transmembrane protein 11)