NRP1 (neuropilin 1)

Gene

• Entrez ID: 8829
• Gene name: Neuropilin 1
• Gene symbol: NRP1
• Synonyms (NCBI Gene): BDCA4, CD304, NP1, NRP, VEGF165R
• Chromosome: 10
• Chromosome location: 10p11.22
• Summary: This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, mad

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001352	hsa-miR-1-3p	pSILAC	18668040
MIRT017659	hsa-miR-335-5p	Microarray	18185580
MIRT021183	hsa-miR-186-5p	Sequencing	20371350
MIRT022578	hsa-miR-124-3p	Microarray	18668037
MIRT001352	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT025124	hsa-miR-181a-5p	Microarray	17612493
MIRT025124	hsa-miR-181a-5p	Sequencing	20371350
MIRT031601	hsa-miR-16-5p	Proteomics	18668040
MIRT053764	hsa-miR-338-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24736504
MIRT053764	hsa-miR-338-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24736504
MIRT053764	hsa-miR-338-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24736504
MIRT053764	hsa-miR-338-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24736504
MIRT437471	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	24114198
MIRT437471	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	24114198
MIRT437471	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	24114198
MIRT440089	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440089	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT262367	hsa-miR-206	Luciferase reporter assay	27014911
MIRT731820	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27895497
MIRT731820	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27895497
MIRT732490	hsa-miR-26a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26406949
MIRT732490	hsa-miR-26a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26406949
MIRT440089	hsa-miR-218-5p	Microarray	33439992
MIRT732490	hsa-miR-26a-5p	Microarray	33439992
MIRT017659	hsa-miR-335-5p	Microarray	33439992
MIRT732733	hsa-miR-141-3p	Western blotting, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR	31572065
MIRT734150	hsa-miR-185-3p	Microarray, qRT-PCR, RNA-seq, Western blotting	33846300
MIRT735819	hsa-miR-205-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32420217
MIRT735820	hsa-miR-145-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32420217
MIRT736339	hsa-miR-200c-3p	Western blotting, Immunofluorescence, qRT-PCR	31898520
MIRT022578	hsa-miR-124-3p	Luciferase reporter assay, RNA-seq	33912463
MIRT053764	hsa-miR-338-3p	Western blotting, Microarray, qRT-PCR	33262463
MIRT1194342	hsa-miR-137	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT1194344	hsa-miR-185	CLIP-seq
MIRT1194345	hsa-miR-30a	CLIP-seq
MIRT1194346	hsa-miR-30b	CLIP-seq
MIRT1194347	hsa-miR-30c	CLIP-seq
MIRT1194348	hsa-miR-30d	CLIP-seq
MIRT1194349	hsa-miR-30e	CLIP-seq
MIRT1194350	hsa-miR-3150b-3p	CLIP-seq
MIRT1194351	hsa-miR-3160-3p	CLIP-seq
MIRT1194352	hsa-miR-3175	CLIP-seq
MIRT1194353	hsa-miR-3184	CLIP-seq
MIRT1194354	hsa-miR-340	CLIP-seq
MIRT1194355	hsa-miR-3646	CLIP-seq
MIRT1194356	hsa-miR-3654	CLIP-seq
MIRT1194357	hsa-miR-3910	CLIP-seq
MIRT1194358	hsa-miR-3977	CLIP-seq
MIRT1194359	hsa-miR-423-5p	CLIP-seq
MIRT1194360	hsa-miR-4251	CLIP-seq
MIRT1194361	hsa-miR-4306	CLIP-seq
MIRT1194362	hsa-miR-4329	CLIP-seq
MIRT1194363	hsa-miR-4459	CLIP-seq
MIRT1194364	hsa-miR-4520a-3p	CLIP-seq
MIRT1194365	hsa-miR-4537	CLIP-seq
MIRT1194366	hsa-miR-4638-3p	CLIP-seq
MIRT1194367	hsa-miR-4644	CLIP-seq
MIRT1194368	hsa-miR-4645-3p	CLIP-seq
MIRT1194369	hsa-miR-4688	CLIP-seq
MIRT1194370	hsa-miR-4722-5p	CLIP-seq
MIRT1194371	hsa-miR-4729	CLIP-seq
MIRT1194372	hsa-miR-4777-5p	CLIP-seq
MIRT1194373	hsa-miR-4779	CLIP-seq
MIRT1194374	hsa-miR-4784	CLIP-seq
MIRT1194375	hsa-miR-486-3p	CLIP-seq
MIRT1194376	hsa-miR-513c	CLIP-seq
MIRT1194377	hsa-miR-514b-5p	CLIP-seq
MIRT1194378	hsa-miR-518d-5p	CLIP-seq
MIRT1194379	hsa-miR-519b-5p	CLIP-seq
MIRT1194380	hsa-miR-519c-5p	CLIP-seq
MIRT1194381	hsa-miR-520c-5p	CLIP-seq
MIRT1194382	hsa-miR-526a	CLIP-seq
MIRT1194383	hsa-miR-548a-3p	CLIP-seq
MIRT1194384	hsa-miR-548an	CLIP-seq
MIRT1194385	hsa-miR-548e	CLIP-seq
MIRT1194386	hsa-miR-548f	CLIP-seq
MIRT1194387	hsa-miR-561	CLIP-seq
MIRT1194388	hsa-miR-580	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT1194390	hsa-miR-616	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT1194344	hsa-miR-185	CLIP-seq
MIRT1194350	hsa-miR-3150b-3p	CLIP-seq
MIRT1194353	hsa-miR-3184	CLIP-seq
MIRT1194359	hsa-miR-423-5p	CLIP-seq
MIRT1194361	hsa-miR-4306	CLIP-seq
MIRT1194367	hsa-miR-4644	CLIP-seq
MIRT1194369	hsa-miR-4688	CLIP-seq
MIRT1194370	hsa-miR-4722-5p	CLIP-seq
MIRT1194374	hsa-miR-4784	CLIP-seq
MIRT1194375	hsa-miR-486-3p	CLIP-seq
MIRT2056415	hsa-miR-101	CLIP-seq
MIRT2056416	hsa-miR-1202	CLIP-seq
MIRT2056417	hsa-miR-1226	CLIP-seq
MIRT2056418	hsa-miR-1237	CLIP-seq
MIRT2056419	hsa-miR-1248	CLIP-seq
MIRT2056420	hsa-miR-1272	CLIP-seq
MIRT2056421	hsa-miR-1276	CLIP-seq
MIRT2056422	hsa-miR-1278	CLIP-seq
MIRT2056423	hsa-miR-1290	CLIP-seq
MIRT2056424	hsa-miR-1322	CLIP-seq
MIRT2056425	hsa-miR-134	CLIP-seq
MIRT2056426	hsa-miR-139-5p	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT2056427	hsa-miR-150	CLIP-seq
MIRT2056428	hsa-miR-151-3p	CLIP-seq
MIRT2056429	hsa-miR-181a	CLIP-seq
MIRT2056430	hsa-miR-181b	CLIP-seq
MIRT2056431	hsa-miR-181c	CLIP-seq
MIRT2056432	hsa-miR-181d	CLIP-seq
MIRT1194344	hsa-miR-185	CLIP-seq
MIRT2056433	hsa-miR-1912	CLIP-seq
MIRT2056434	hsa-miR-194	CLIP-seq
MIRT2056435	hsa-miR-197	CLIP-seq
MIRT2056436	hsa-miR-214	CLIP-seq
MIRT2056437	hsa-miR-2278	CLIP-seq
MIRT2056438	hsa-miR-2467-5p	CLIP-seq
MIRT2056439	hsa-miR-3065-5p	CLIP-seq
MIRT2056440	hsa-miR-3074-3p	CLIP-seq
MIRT1194345	hsa-miR-30a	CLIP-seq
MIRT1194346	hsa-miR-30b	CLIP-seq
MIRT1194347	hsa-miR-30c	CLIP-seq
MIRT1194348	hsa-miR-30d	CLIP-seq
MIRT1194349	hsa-miR-30e	CLIP-seq
MIRT2056441	hsa-miR-3118	CLIP-seq
MIRT2056442	hsa-miR-3130-5p	CLIP-seq
MIRT2056443	hsa-miR-3133	CLIP-seq
MIRT1194350	hsa-miR-3150b-3p	CLIP-seq
MIRT2056444	hsa-miR-3152-5p	CLIP-seq
MIRT2056445	hsa-miR-3158-3p	CLIP-seq
MIRT2056446	hsa-miR-3164	CLIP-seq
MIRT2056447	hsa-miR-3167	CLIP-seq
MIRT1194352	hsa-miR-3175	CLIP-seq
MIRT2056448	hsa-miR-3188	CLIP-seq
MIRT2056449	hsa-miR-3194-5p	CLIP-seq
MIRT2056450	hsa-miR-320b	CLIP-seq
MIRT2056451	hsa-miR-320c	CLIP-seq
MIRT2056452	hsa-miR-320d	CLIP-seq
MIRT2056453	hsa-miR-3616-3p	CLIP-seq
MIRT2056454	hsa-miR-3619-5p	CLIP-seq
MIRT1194355	hsa-miR-3646	CLIP-seq
MIRT2056455	hsa-miR-3669	CLIP-seq
MIRT2056456	hsa-miR-3940-5p	CLIP-seq
MIRT2056457	hsa-miR-3972	CLIP-seq
MIRT2056458	hsa-miR-3975	CLIP-seq
MIRT2056459	hsa-miR-4262	CLIP-seq
MIRT2056460	hsa-miR-4291	CLIP-seq
MIRT1194361	hsa-miR-4306	CLIP-seq
MIRT2056461	hsa-miR-4311	CLIP-seq
MIRT2056462	hsa-miR-432	CLIP-seq
MIRT2056463	hsa-miR-4328	CLIP-seq
MIRT2056464	hsa-miR-4426	CLIP-seq
MIRT2056465	hsa-miR-4429	CLIP-seq
MIRT2056466	hsa-miR-4443	CLIP-seq
MIRT2056467	hsa-miR-4482	CLIP-seq
MIRT2056468	hsa-miR-4501	CLIP-seq
MIRT2056469	hsa-miR-4507	CLIP-seq
MIRT2056470	hsa-miR-451b	CLIP-seq
MIRT1194365	hsa-miR-4537	CLIP-seq
MIRT1194367	hsa-miR-4644	CLIP-seq
MIRT2056471	hsa-miR-4647	CLIP-seq
MIRT2056472	hsa-miR-4649-3p	CLIP-seq
MIRT2056473	hsa-miR-4662b	CLIP-seq
MIRT2056474	hsa-miR-4712-5p	CLIP-seq
MIRT2056475	hsa-miR-4733-3p	CLIP-seq
MIRT2056476	hsa-miR-4774-3p	CLIP-seq
MIRT1194372	hsa-miR-4777-5p	CLIP-seq
MIRT1194374	hsa-miR-4784	CLIP-seq
MIRT2056477	hsa-miR-4789-5p	CLIP-seq
MIRT2056478	hsa-miR-485-5p	CLIP-seq
MIRT2056479	hsa-miR-500a	CLIP-seq
MIRT2056480	hsa-miR-501-3p	CLIP-seq
MIRT2056481	hsa-miR-502-3p	CLIP-seq
MIRT2056482	hsa-miR-5096	CLIP-seq
MIRT2056483	hsa-miR-513a-3p	CLIP-seq
MIRT1194378	hsa-miR-518d-5p	CLIP-seq
MIRT1194379	hsa-miR-519b-5p	CLIP-seq
MIRT1194380	hsa-miR-519c-5p	CLIP-seq
MIRT1194381	hsa-miR-520c-5p	CLIP-seq
MIRT1194382	hsa-miR-526a	CLIP-seq
MIRT2056484	hsa-miR-548aa	CLIP-seq
MIRT2056485	hsa-miR-548v	CLIP-seq
MIRT2056486	hsa-miR-549	CLIP-seq
MIRT2056487	hsa-miR-569	CLIP-seq
MIRT2056488	hsa-miR-570	CLIP-seq
MIRT2056489	hsa-miR-583	CLIP-seq
MIRT2056490	hsa-miR-587	CLIP-seq
MIRT2056491	hsa-miR-590-3p	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT2056492	hsa-miR-634	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT2056493	hsa-miR-761	CLIP-seq
MIRT2056494	hsa-miR-770-5p	CLIP-seq
MIRT2056495	hsa-miR-876-5p	CLIP-seq
MIRT2056496	hsa-miR-9	CLIP-seq
MIRT2056497	hsa-miR-922	CLIP-seq
MIRT2056415	hsa-miR-101	CLIP-seq
MIRT2056416	hsa-miR-1202	CLIP-seq
MIRT2056417	hsa-miR-1226	CLIP-seq
MIRT2056418	hsa-miR-1237	CLIP-seq
MIRT2056419	hsa-miR-1248	CLIP-seq
MIRT2056421	hsa-miR-1276	CLIP-seq
MIRT2056422	hsa-miR-1278	CLIP-seq
MIRT2284937	hsa-miR-1289	CLIP-seq
MIRT2056425	hsa-miR-134	CLIP-seq
MIRT2284938	hsa-miR-1343	CLIP-seq
MIRT1194342	hsa-miR-137	CLIP-seq
MIRT2284939	hsa-miR-139-3p	CLIP-seq
MIRT2056426	hsa-miR-139-5p	CLIP-seq
MIRT2284940	hsa-miR-141	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT2056429	hsa-miR-181a	CLIP-seq
MIRT2056430	hsa-miR-181b	CLIP-seq
MIRT2056431	hsa-miR-181c	CLIP-seq
MIRT2056432	hsa-miR-181d	CLIP-seq
MIRT2056434	hsa-miR-194	CLIP-seq
MIRT2056435	hsa-miR-197	CLIP-seq
MIRT2284941	hsa-miR-200a	CLIP-seq
MIRT2284942	hsa-miR-2276	CLIP-seq
MIRT2056437	hsa-miR-2278	CLIP-seq
MIRT2056438	hsa-miR-2467-5p	CLIP-seq
MIRT2284943	hsa-miR-299-3p	CLIP-seq
MIRT2284944	hsa-miR-3074-5p	CLIP-seq
MIRT2056441	hsa-miR-3118	CLIP-seq
MIRT2284945	hsa-miR-3124-3p	CLIP-seq
MIRT2056445	hsa-miR-3158-3p	CLIP-seq
MIRT2284946	hsa-miR-3160-5p	CLIP-seq
MIRT2056446	hsa-miR-3164	CLIP-seq
MIRT2056448	hsa-miR-3188	CLIP-seq
MIRT2056449	hsa-miR-3194-5p	CLIP-seq
MIRT2284947	hsa-miR-3591-3p	CLIP-seq
MIRT2284948	hsa-miR-3647-3p	CLIP-seq
MIRT1194356	hsa-miR-3654	CLIP-seq
MIRT2056455	hsa-miR-3669	CLIP-seq
MIRT2284949	hsa-miR-3690	CLIP-seq
MIRT2284950	hsa-miR-3908	CLIP-seq
MIRT2284951	hsa-miR-3942-5p	CLIP-seq
MIRT2056457	hsa-miR-3972	CLIP-seq
MIRT2056458	hsa-miR-3975	CLIP-seq
MIRT2284952	hsa-miR-4254	CLIP-seq
MIRT2056459	hsa-miR-4262	CLIP-seq
MIRT2056461	hsa-miR-4311	CLIP-seq
MIRT2284953	hsa-miR-4433	CLIP-seq
MIRT1194363	hsa-miR-4459	CLIP-seq
MIRT2284954	hsa-miR-4470	CLIP-seq
MIRT2284955	hsa-miR-4473	CLIP-seq
MIRT2284956	hsa-miR-4481	CLIP-seq
MIRT2284957	hsa-miR-4490	CLIP-seq
MIRT2056470	hsa-miR-451b	CLIP-seq
MIRT1194364	hsa-miR-4520a-3p	CLIP-seq
MIRT1194365	hsa-miR-4537	CLIP-seq
MIRT1194366	hsa-miR-4638-3p	CLIP-seq
MIRT2284958	hsa-miR-4640-5p	CLIP-seq
MIRT1194368	hsa-miR-4645-3p	CLIP-seq
MIRT2056472	hsa-miR-4649-3p	CLIP-seq
MIRT2284959	hsa-miR-4659a-3p	CLIP-seq
MIRT2284960	hsa-miR-4659b-3p	CLIP-seq
MIRT2284961	hsa-miR-4691-5p	CLIP-seq
MIRT2284962	hsa-miR-4697-3p	CLIP-seq
MIRT2284963	hsa-miR-4703-5p	CLIP-seq
MIRT2056474	hsa-miR-4712-5p	CLIP-seq
MIRT2284964	hsa-miR-4726-5p	CLIP-seq
MIRT2284965	hsa-miR-4731-3p	CLIP-seq
MIRT2056475	hsa-miR-4733-3p	CLIP-seq
MIRT2284966	hsa-miR-4745-5p	CLIP-seq
MIRT2284967	hsa-miR-4766-3p	CLIP-seq
MIRT2284968	hsa-miR-4768-3p	CLIP-seq
MIRT2284969	hsa-miR-4774-5p	CLIP-seq
MIRT1194372	hsa-miR-4777-5p	CLIP-seq
MIRT2284970	hsa-miR-4778-3p	CLIP-seq
MIRT2056477	hsa-miR-4789-5p	CLIP-seq
MIRT2284971	hsa-miR-4801	CLIP-seq
MIRT2056478	hsa-miR-485-5p	CLIP-seq
MIRT2056479	hsa-miR-500a	CLIP-seq
MIRT2056480	hsa-miR-501-3p	CLIP-seq
MIRT2056481	hsa-miR-502-3p	CLIP-seq
MIRT2056482	hsa-miR-5096	CLIP-seq
MIRT2284972	hsa-miR-512-3p	CLIP-seq
MIRT1194378	hsa-miR-518d-5p	CLIP-seq
MIRT1194379	hsa-miR-519b-5p	CLIP-seq
MIRT1194380	hsa-miR-519c-5p	CLIP-seq
MIRT1194381	hsa-miR-520c-5p	CLIP-seq
MIRT2284973	hsa-miR-520d-5p	CLIP-seq
MIRT2284974	hsa-miR-520f	CLIP-seq
MIRT2284975	hsa-miR-524-5p	CLIP-seq
MIRT1194382	hsa-miR-526a	CLIP-seq
MIRT1194383	hsa-miR-548a-3p	CLIP-seq
MIRT2056484	hsa-miR-548aa	CLIP-seq
MIRT1194385	hsa-miR-548e	CLIP-seq
MIRT1194386	hsa-miR-548f	CLIP-seq
MIRT2056485	hsa-miR-548v	CLIP-seq
MIRT2056488	hsa-miR-570	CLIP-seq
MIRT2056489	hsa-miR-583	CLIP-seq
MIRT2056490	hsa-miR-587	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT2056492	hsa-miR-634	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT2284976	hsa-miR-759	CLIP-seq
MIRT2056494	hsa-miR-770-5p	CLIP-seq
MIRT2284977	hsa-miR-890	CLIP-seq
MIRT2056415	hsa-miR-101	CLIP-seq
MIRT2056422	hsa-miR-1278	CLIP-seq
MIRT2056426	hsa-miR-139-5p	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT2056433	hsa-miR-1912	CLIP-seq
MIRT2056436	hsa-miR-214	CLIP-seq
MIRT2056438	hsa-miR-2467-5p	CLIP-seq
MIRT2056442	hsa-miR-3130-5p	CLIP-seq
MIRT2056448	hsa-miR-3188	CLIP-seq
MIRT2056449	hsa-miR-3194-5p	CLIP-seq
MIRT2056454	hsa-miR-3619-5p	CLIP-seq
MIRT2391758	hsa-miR-3677-5p	CLIP-seq
MIRT2056458	hsa-miR-3975	CLIP-seq
MIRT2391759	hsa-miR-4435	CLIP-seq
MIRT2056467	hsa-miR-4482	CLIP-seq
MIRT1194365	hsa-miR-4537	CLIP-seq
MIRT2284958	hsa-miR-4640-5p	CLIP-seq
MIRT2056472	hsa-miR-4649-3p	CLIP-seq
MIRT2284962	hsa-miR-4697-3p	CLIP-seq
MIRT2056474	hsa-miR-4712-5p	CLIP-seq
MIRT2284964	hsa-miR-4726-5p	CLIP-seq
MIRT1194372	hsa-miR-4777-5p	CLIP-seq
MIRT2056478	hsa-miR-485-5p	CLIP-seq
MIRT1194378	hsa-miR-518d-5p	CLIP-seq
MIRT1194379	hsa-miR-519b-5p	CLIP-seq
MIRT1194380	hsa-miR-519c-5p	CLIP-seq
MIRT1194381	hsa-miR-520c-5p	CLIP-seq
MIRT1194382	hsa-miR-526a	CLIP-seq
MIRT2056485	hsa-miR-548v	CLIP-seq
MIRT2056488	hsa-miR-570	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT2056493	hsa-miR-761	CLIP-seq
MIRT2056494	hsa-miR-770-5p	CLIP-seq
MIRT2431639	hsa-miR-149	CLIP-seq
MIRT2431640	hsa-miR-24	CLIP-seq
MIRT2431641	hsa-miR-3545-5p	CLIP-seq
MIRT1194360	hsa-miR-4251	CLIP-seq
MIRT2431642	hsa-miR-4284	CLIP-seq
MIRT2431643	hsa-miR-539	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT2056415	hsa-miR-101	CLIP-seq
MIRT2056422	hsa-miR-1278	CLIP-seq
MIRT2056426	hsa-miR-139-5p	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT2056438	hsa-miR-2467-5p	CLIP-seq
MIRT2056448	hsa-miR-3188	CLIP-seq
MIRT2056458	hsa-miR-3975	CLIP-seq
MIRT2056472	hsa-miR-4649-3p	CLIP-seq
MIRT2056474	hsa-miR-4712-5p	CLIP-seq
MIRT2056478	hsa-miR-485-5p	CLIP-seq
MIRT2056485	hsa-miR-548v	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT2056494	hsa-miR-770-5p	CLIP-seq
MIRT2056415	hsa-miR-101	CLIP-seq
MIRT2582824	hsa-miR-1200	CLIP-seq
MIRT2056416	hsa-miR-1202	CLIP-seq
MIRT2582825	hsa-miR-1206	CLIP-seq
MIRT2056417	hsa-miR-1226	CLIP-seq
MIRT2056418	hsa-miR-1237	CLIP-seq
MIRT2582826	hsa-miR-124	CLIP-seq
MIRT2056419	hsa-miR-1248	CLIP-seq
MIRT2582827	hsa-miR-1252	CLIP-seq
MIRT2582828	hsa-miR-1254	CLIP-seq
MIRT2582829	hsa-miR-1258	CLIP-seq
MIRT2056420	hsa-miR-1272	CLIP-seq
MIRT2582830	hsa-miR-127-5p	CLIP-seq
MIRT2056421	hsa-miR-1276	CLIP-seq
MIRT2056422	hsa-miR-1278	CLIP-seq
MIRT2582831	hsa-miR-1279	CLIP-seq
MIRT2582832	hsa-miR-1282	CLIP-seq
MIRT2582833	hsa-miR-1285	CLIP-seq
MIRT2284937	hsa-miR-1289	CLIP-seq
MIRT2056423	hsa-miR-1290	CLIP-seq
MIRT2582834	hsa-miR-1298	CLIP-seq
MIRT2056424	hsa-miR-1322	CLIP-seq
MIRT2284939	hsa-miR-139-3p	CLIP-seq
MIRT2056426	hsa-miR-139-5p	CLIP-seq
MIRT2582835	hsa-miR-142-5p	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT2431639	hsa-miR-149	CLIP-seq
MIRT2056428	hsa-miR-151-3p	CLIP-seq
MIRT2582836	hsa-miR-1825	CLIP-seq
MIRT1194344	hsa-miR-185	CLIP-seq
MIRT2582837	hsa-miR-186	CLIP-seq
MIRT2582838	hsa-miR-1914	CLIP-seq
MIRT2056434	hsa-miR-194	CLIP-seq
MIRT2056435	hsa-miR-197	CLIP-seq
MIRT2582839	hsa-miR-199a-3p	CLIP-seq
MIRT2582840	hsa-miR-199b-3p	CLIP-seq
MIRT2582841	hsa-miR-203	CLIP-seq
MIRT2582842	hsa-miR-204	CLIP-seq
MIRT2582843	hsa-miR-211	CLIP-seq
MIRT2582844	hsa-miR-2115	CLIP-seq
MIRT2582845	hsa-miR-2116	CLIP-seq
MIRT2582846	hsa-miR-2117	CLIP-seq
MIRT2056436	hsa-miR-214	CLIP-seq
MIRT2582847	hsa-miR-216a	CLIP-seq
MIRT2284942	hsa-miR-2276	CLIP-seq
MIRT2056437	hsa-miR-2278	CLIP-seq
MIRT2431640	hsa-miR-24	CLIP-seq
MIRT2056438	hsa-miR-2467-5p	CLIP-seq
MIRT2284943	hsa-miR-299-3p	CLIP-seq
MIRT2582848	hsa-miR-3116	CLIP-seq
MIRT2582849	hsa-miR-3129-5p	CLIP-seq
MIRT2582850	hsa-miR-3130-3p	CLIP-seq
MIRT2582851	hsa-miR-3145-3p	CLIP-seq
MIRT2582852	hsa-miR-3148	CLIP-seq
MIRT1194350	hsa-miR-3150b-3p	CLIP-seq
MIRT2056444	hsa-miR-3152-5p	CLIP-seq
MIRT2582853	hsa-miR-3156-5p	CLIP-seq
MIRT2056445	hsa-miR-3158-3p	CLIP-seq
MIRT2056447	hsa-miR-3167	CLIP-seq
MIRT1194352	hsa-miR-3175	CLIP-seq
MIRT2582854	hsa-miR-3187-5p	CLIP-seq
MIRT2056448	hsa-miR-3188	CLIP-seq
MIRT2056449	hsa-miR-3194-5p	CLIP-seq
MIRT2056450	hsa-miR-320b	CLIP-seq
MIRT2056451	hsa-miR-320c	CLIP-seq
MIRT2056452	hsa-miR-320d	CLIP-seq
MIRT2582855	hsa-miR-325	CLIP-seq
MIRT2582856	hsa-miR-339-5p	CLIP-seq
MIRT2431641	hsa-miR-3545-5p	CLIP-seq
MIRT2582857	hsa-miR-3607-3p	CLIP-seq
MIRT2582858	hsa-miR-361-3p	CLIP-seq
MIRT2056453	hsa-miR-3616-3p	CLIP-seq
MIRT2056454	hsa-miR-3619-5p	CLIP-seq
MIRT2582859	hsa-miR-3622b-5p	CLIP-seq
MIRT1194355	hsa-miR-3646	CLIP-seq
MIRT2056455	hsa-miR-3669	CLIP-seq
MIRT2582860	hsa-miR-3686	CLIP-seq
MIRT2582861	hsa-miR-376a	CLIP-seq
MIRT2582862	hsa-miR-376b	CLIP-seq
MIRT2582863	hsa-miR-376c	CLIP-seq
MIRT2582864	hsa-miR-378g	CLIP-seq
MIRT2284950	hsa-miR-3908	CLIP-seq
MIRT2582865	hsa-miR-3929	CLIP-seq
MIRT2056456	hsa-miR-3940-5p	CLIP-seq
MIRT2284951	hsa-miR-3942-5p	CLIP-seq
MIRT2056457	hsa-miR-3972	CLIP-seq
MIRT2056458	hsa-miR-3975	CLIP-seq
MIRT1194358	hsa-miR-3977	CLIP-seq
MIRT1194360	hsa-miR-4251	CLIP-seq
MIRT2431642	hsa-miR-4284	CLIP-seq
MIRT1194361	hsa-miR-4306	CLIP-seq
MIRT2056461	hsa-miR-4311	CLIP-seq
MIRT2582866	hsa-miR-4314	CLIP-seq
MIRT2056462	hsa-miR-432	CLIP-seq
MIRT2582867	hsa-miR-4324	CLIP-seq
MIRT2056463	hsa-miR-4328	CLIP-seq
MIRT2582868	hsa-miR-4419b	CLIP-seq
MIRT2056465	hsa-miR-4429	CLIP-seq
MIRT2284953	hsa-miR-4433	CLIP-seq
MIRT2056466	hsa-miR-4443	CLIP-seq
MIRT2582869	hsa-miR-4446-5p	CLIP-seq
MIRT2582870	hsa-miR-4448	CLIP-seq
MIRT2582871	hsa-miR-4457	CLIP-seq
MIRT1194363	hsa-miR-4459	CLIP-seq
MIRT2582872	hsa-miR-4478	CLIP-seq
MIRT2582873	hsa-miR-4480	CLIP-seq
MIRT2284956	hsa-miR-4481	CLIP-seq
MIRT2582874	hsa-miR-4486	CLIP-seq
MIRT2284957	hsa-miR-4490	CLIP-seq
MIRT2056469	hsa-miR-4507	CLIP-seq
MIRT2056470	hsa-miR-451b	CLIP-seq
MIRT2582875	hsa-miR-4530	CLIP-seq
MIRT2582876	hsa-miR-4533	CLIP-seq
MIRT2284958	hsa-miR-4640-5p	CLIP-seq
MIRT1194367	hsa-miR-4644	CLIP-seq
MIRT2582877	hsa-miR-4645-5p	CLIP-seq
MIRT2582878	hsa-miR-4648	CLIP-seq
MIRT2056472	hsa-miR-4649-3p	CLIP-seq
MIRT2582879	hsa-miR-4652-3p	CLIP-seq
MIRT2582880	hsa-miR-4653-3p	CLIP-seq
MIRT2582881	hsa-miR-4654	CLIP-seq
MIRT2284959	hsa-miR-4659a-3p	CLIP-seq
MIRT2582882	hsa-miR-4659a-5p	CLIP-seq
MIRT2284960	hsa-miR-4659b-3p	CLIP-seq
MIRT2582883	hsa-miR-4659b-5p	CLIP-seq
MIRT2582884	hsa-miR-4662a-3p	CLIP-seq
MIRT2582885	hsa-miR-4668-3p	CLIP-seq
MIRT2582886	hsa-miR-4673	CLIP-seq
MIRT2582887	hsa-miR-4676-5p	CLIP-seq
MIRT2582888	hsa-miR-4677-5p	CLIP-seq
MIRT2284962	hsa-miR-4697-3p	CLIP-seq
MIRT2284963	hsa-miR-4703-5p	CLIP-seq
MIRT2582889	hsa-miR-4711-5p	CLIP-seq
MIRT2056474	hsa-miR-4712-5p	CLIP-seq
MIRT2582890	hsa-miR-4716-5p	CLIP-seq
MIRT2284964	hsa-miR-4726-5p	CLIP-seq
MIRT1194371	hsa-miR-4729	CLIP-seq
MIRT2284965	hsa-miR-4731-3p	CLIP-seq
MIRT2056475	hsa-miR-4733-3p	CLIP-seq
MIRT2582891	hsa-miR-4742-3p	CLIP-seq
MIRT2284966	hsa-miR-4745-5p	CLIP-seq
MIRT2582892	hsa-miR-4746-3p	CLIP-seq
MIRT2582893	hsa-miR-4747-5p	CLIP-seq
MIRT2582894	hsa-miR-4753-3p	CLIP-seq
MIRT2582895	hsa-miR-4755-5p	CLIP-seq
MIRT2582896	hsa-miR-4760-3p	CLIP-seq
MIRT2284967	hsa-miR-4766-3p	CLIP-seq
MIRT2284968	hsa-miR-4768-3p	CLIP-seq
MIRT2582897	hsa-miR-4769-5p	CLIP-seq
MIRT2056476	hsa-miR-4774-3p	CLIP-seq
MIRT2582898	hsa-miR-4775	CLIP-seq
MIRT2582899	hsa-miR-4776-3p	CLIP-seq
MIRT2284970	hsa-miR-4778-3p	CLIP-seq
MIRT2582900	hsa-miR-4778-5p	CLIP-seq
MIRT1194374	hsa-miR-4784	CLIP-seq
MIRT2056477	hsa-miR-4789-5p	CLIP-seq
MIRT2582901	hsa-miR-4793-3p	CLIP-seq
MIRT2582902	hsa-miR-4797-3p	CLIP-seq
MIRT2284971	hsa-miR-4801	CLIP-seq
MIRT2582903	hsa-miR-4802-5p	CLIP-seq
MIRT2582904	hsa-miR-4803	CLIP-seq
MIRT2056478	hsa-miR-485-5p	CLIP-seq
MIRT2582905	hsa-miR-494	CLIP-seq
MIRT2056479	hsa-miR-500a	CLIP-seq
MIRT2056480	hsa-miR-501-3p	CLIP-seq
MIRT2056481	hsa-miR-502-3p	CLIP-seq
MIRT2582906	hsa-miR-506	CLIP-seq
MIRT2056482	hsa-miR-5096	CLIP-seq
MIRT2582907	hsa-miR-513b	CLIP-seq
MIRT2582908	hsa-miR-516a-3p	CLIP-seq
MIRT2431643	hsa-miR-539	CLIP-seq
MIRT2582909	hsa-miR-544b	CLIP-seq
MIRT2056484	hsa-miR-548aa	CLIP-seq
MIRT1194384	hsa-miR-548an	CLIP-seq
MIRT2582910	hsa-miR-548c-3p	CLIP-seq
MIRT2582911	hsa-miR-548p	CLIP-seq
MIRT2056485	hsa-miR-548v	CLIP-seq
MIRT1194387	hsa-miR-561	CLIP-seq
MIRT2056487	hsa-miR-569	CLIP-seq
MIRT2056488	hsa-miR-570	CLIP-seq
MIRT2582912	hsa-miR-575	CLIP-seq
MIRT2582913	hsa-miR-579	CLIP-seq
MIRT1194388	hsa-miR-580	CLIP-seq
MIRT2056489	hsa-miR-583	CLIP-seq
MIRT2056491	hsa-miR-590-3p	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT2582914	hsa-miR-612	CLIP-seq
MIRT1194390	hsa-miR-616	CLIP-seq
MIRT2582915	hsa-miR-623	CLIP-seq
MIRT2582916	hsa-miR-628-3p	CLIP-seq
MIRT2582917	hsa-miR-629	CLIP-seq
MIRT2056492	hsa-miR-634	CLIP-seq
MIRT2582918	hsa-miR-635	CLIP-seq
MIRT2582919	hsa-miR-639	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT2582920	hsa-miR-654-3p	CLIP-seq
MIRT2582921	hsa-miR-657	CLIP-seq
MIRT2582922	hsa-miR-661	CLIP-seq
MIRT2582923	hsa-miR-668	CLIP-seq
MIRT2582924	hsa-miR-670	CLIP-seq
MIRT2284976	hsa-miR-759	CLIP-seq
MIRT2056493	hsa-miR-761	CLIP-seq
MIRT2056494	hsa-miR-770-5p	CLIP-seq
MIRT2056495	hsa-miR-876-5p	CLIP-seq
MIRT2056496	hsa-miR-9	CLIP-seq
MIRT2582925	hsa-miR-936	CLIP-seq
MIRT2056415	hsa-miR-101	CLIP-seq
MIRT2582824	hsa-miR-1200	CLIP-seq
MIRT2582825	hsa-miR-1206	CLIP-seq
MIRT2056417	hsa-miR-1226	CLIP-seq
MIRT2056418	hsa-miR-1237	CLIP-seq
MIRT2582826	hsa-miR-124	CLIP-seq
MIRT2056419	hsa-miR-1248	CLIP-seq
MIRT2582827	hsa-miR-1252	CLIP-seq
MIRT2582828	hsa-miR-1254	CLIP-seq
MIRT2582829	hsa-miR-1258	CLIP-seq
MIRT2056420	hsa-miR-1272	CLIP-seq
MIRT2582830	hsa-miR-127-5p	CLIP-seq
MIRT2056421	hsa-miR-1276	CLIP-seq
MIRT2056422	hsa-miR-1278	CLIP-seq
MIRT2582831	hsa-miR-1279	CLIP-seq
MIRT2582832	hsa-miR-1282	CLIP-seq
MIRT2582833	hsa-miR-1285	CLIP-seq
MIRT2284937	hsa-miR-1289	CLIP-seq
MIRT2582834	hsa-miR-1298	CLIP-seq
MIRT2056424	hsa-miR-1322	CLIP-seq
MIRT2284939	hsa-miR-139-3p	CLIP-seq
MIRT2056426	hsa-miR-139-5p	CLIP-seq
MIRT2582835	hsa-miR-142-5p	CLIP-seq
MIRT1194343	hsa-miR-144	CLIP-seq
MIRT2431639	hsa-miR-149	CLIP-seq
MIRT2056428	hsa-miR-151-3p	CLIP-seq
MIRT2582838	hsa-miR-1914	CLIP-seq
MIRT2056434	hsa-miR-194	CLIP-seq
MIRT2056435	hsa-miR-197	CLIP-seq
MIRT2582841	hsa-miR-203	CLIP-seq
MIRT2582842	hsa-miR-204	CLIP-seq
MIRT2582843	hsa-miR-211	CLIP-seq
MIRT2582844	hsa-miR-2115	CLIP-seq
MIRT2056436	hsa-miR-214	CLIP-seq
MIRT2582847	hsa-miR-216a	CLIP-seq
MIRT2056437	hsa-miR-2278	CLIP-seq
MIRT2431640	hsa-miR-24	CLIP-seq
MIRT2056438	hsa-miR-2467-5p	CLIP-seq
MIRT2284943	hsa-miR-299-3p	CLIP-seq
MIRT2582848	hsa-miR-3116	CLIP-seq
MIRT2582850	hsa-miR-3130-3p	CLIP-seq
MIRT2582851	hsa-miR-3145-3p	CLIP-seq
MIRT2056444	hsa-miR-3152-5p	CLIP-seq
MIRT2582853	hsa-miR-3156-5p	CLIP-seq
MIRT2056445	hsa-miR-3158-3p	CLIP-seq
MIRT2582854	hsa-miR-3187-5p	CLIP-seq
MIRT2056448	hsa-miR-3188	CLIP-seq
MIRT2056450	hsa-miR-320b	CLIP-seq
MIRT2056451	hsa-miR-320c	CLIP-seq
MIRT2056452	hsa-miR-320d	CLIP-seq
MIRT2582855	hsa-miR-325	CLIP-seq
MIRT2582856	hsa-miR-339-5p	CLIP-seq
MIRT2431641	hsa-miR-3545-5p	CLIP-seq
MIRT2582857	hsa-miR-3607-3p	CLIP-seq
MIRT2582858	hsa-miR-361-3p	CLIP-seq
MIRT2056453	hsa-miR-3616-3p	CLIP-seq
MIRT2056454	hsa-miR-3619-5p	CLIP-seq
MIRT2582859	hsa-miR-3622b-5p	CLIP-seq
MIRT2582860	hsa-miR-3686	CLIP-seq
MIRT2582861	hsa-miR-376a	CLIP-seq
MIRT2582862	hsa-miR-376b	CLIP-seq
MIRT2582863	hsa-miR-376c	CLIP-seq
MIRT2582864	hsa-miR-378g	CLIP-seq
MIRT2284950	hsa-miR-3908	CLIP-seq
MIRT2582865	hsa-miR-3929	CLIP-seq
MIRT2056456	hsa-miR-3940-5p	CLIP-seq
MIRT2284951	hsa-miR-3942-5p	CLIP-seq
MIRT2056458	hsa-miR-3975	CLIP-seq
MIRT1194358	hsa-miR-3977	CLIP-seq
MIRT1194360	hsa-miR-4251	CLIP-seq
MIRT2431642	hsa-miR-4284	CLIP-seq
MIRT2056461	hsa-miR-4311	CLIP-seq
MIRT2582866	hsa-miR-4314	CLIP-seq
MIRT2582867	hsa-miR-4324	CLIP-seq
MIRT2582868	hsa-miR-4419b	CLIP-seq
MIRT2056465	hsa-miR-4429	CLIP-seq
MIRT2284953	hsa-miR-4433	CLIP-seq
MIRT2056466	hsa-miR-4443	CLIP-seq
MIRT2582869	hsa-miR-4446-5p	CLIP-seq
MIRT2582870	hsa-miR-4448	CLIP-seq
MIRT1194363	hsa-miR-4459	CLIP-seq
MIRT2582872	hsa-miR-4478	CLIP-seq
MIRT2284956	hsa-miR-4481	CLIP-seq
MIRT2582874	hsa-miR-4486	CLIP-seq
MIRT2284957	hsa-miR-4490	CLIP-seq
MIRT2056469	hsa-miR-4507	CLIP-seq
MIRT2056470	hsa-miR-451b	CLIP-seq
MIRT2582875	hsa-miR-4530	CLIP-seq
MIRT2582876	hsa-miR-4533	CLIP-seq
MIRT2284958	hsa-miR-4640-5p	CLIP-seq
MIRT2582877	hsa-miR-4645-5p	CLIP-seq
MIRT2582878	hsa-miR-4648	CLIP-seq
MIRT2056472	hsa-miR-4649-3p	CLIP-seq
MIRT2582879	hsa-miR-4652-3p	CLIP-seq
MIRT2582881	hsa-miR-4654	CLIP-seq
MIRT2284959	hsa-miR-4659a-3p	CLIP-seq
MIRT2582882	hsa-miR-4659a-5p	CLIP-seq
MIRT2284960	hsa-miR-4659b-3p	CLIP-seq
MIRT2582883	hsa-miR-4659b-5p	CLIP-seq
MIRT2582884	hsa-miR-4662a-3p	CLIP-seq
MIRT2582885	hsa-miR-4668-3p	CLIP-seq
MIRT2582886	hsa-miR-4673	CLIP-seq
MIRT2284962	hsa-miR-4697-3p	CLIP-seq
MIRT2284963	hsa-miR-4703-5p	CLIP-seq
MIRT2582889	hsa-miR-4711-5p	CLIP-seq
MIRT2056474	hsa-miR-4712-5p	CLIP-seq
MIRT2582890	hsa-miR-4716-5p	CLIP-seq
MIRT2284964	hsa-miR-4726-5p	CLIP-seq
MIRT1194371	hsa-miR-4729	CLIP-seq
MIRT2284965	hsa-miR-4731-3p	CLIP-seq
MIRT2056475	hsa-miR-4733-3p	CLIP-seq
MIRT2284966	hsa-miR-4745-5p	CLIP-seq
MIRT2582892	hsa-miR-4746-3p	CLIP-seq
MIRT2582893	hsa-miR-4747-5p	CLIP-seq
MIRT2582895	hsa-miR-4755-5p	CLIP-seq
MIRT2582896	hsa-miR-4760-3p	CLIP-seq
MIRT2284967	hsa-miR-4766-3p	CLIP-seq
MIRT2284968	hsa-miR-4768-3p	CLIP-seq
MIRT2582897	hsa-miR-4769-5p	CLIP-seq
MIRT2056476	hsa-miR-4774-3p	CLIP-seq
MIRT2582898	hsa-miR-4775	CLIP-seq
MIRT2582899	hsa-miR-4776-3p	CLIP-seq
MIRT2284970	hsa-miR-4778-3p	CLIP-seq
MIRT2582900	hsa-miR-4778-5p	CLIP-seq
MIRT2056477	hsa-miR-4789-5p	CLIP-seq
MIRT2582901	hsa-miR-4793-3p	CLIP-seq
MIRT2284971	hsa-miR-4801	CLIP-seq
MIRT2582904	hsa-miR-4803	CLIP-seq
MIRT2056478	hsa-miR-485-5p	CLIP-seq
MIRT2582905	hsa-miR-494	CLIP-seq
MIRT2056479	hsa-miR-500a	CLIP-seq
MIRT2056480	hsa-miR-501-3p	CLIP-seq
MIRT2056481	hsa-miR-502-3p	CLIP-seq
MIRT2582906	hsa-miR-506	CLIP-seq
MIRT2056482	hsa-miR-5096	CLIP-seq
MIRT2582908	hsa-miR-516a-3p	CLIP-seq
MIRT2431643	hsa-miR-539	CLIP-seq
MIRT2582909	hsa-miR-544b	CLIP-seq
MIRT2056484	hsa-miR-548aa	CLIP-seq
MIRT1194384	hsa-miR-548an	CLIP-seq
MIRT2582910	hsa-miR-548c-3p	CLIP-seq
MIRT2056485	hsa-miR-548v	CLIP-seq
MIRT1194387	hsa-miR-561	CLIP-seq
MIRT2056487	hsa-miR-569	CLIP-seq
MIRT2056488	hsa-miR-570	CLIP-seq
MIRT2582913	hsa-miR-579	CLIP-seq
MIRT1194388	hsa-miR-580	CLIP-seq
MIRT2056489	hsa-miR-583	CLIP-seq
MIRT2056491	hsa-miR-590-3p	CLIP-seq
MIRT1194389	hsa-miR-603	CLIP-seq
MIRT2582914	hsa-miR-612	CLIP-seq
MIRT1194390	hsa-miR-616	CLIP-seq
MIRT2582915	hsa-miR-623	CLIP-seq
MIRT2582916	hsa-miR-628-3p	CLIP-seq
MIRT2582917	hsa-miR-629	CLIP-seq
MIRT2056492	hsa-miR-634	CLIP-seq
MIRT2582919	hsa-miR-639	CLIP-seq
MIRT1194391	hsa-miR-642b	CLIP-seq
MIRT2582920	hsa-miR-654-3p	CLIP-seq
MIRT2582921	hsa-miR-657	CLIP-seq
MIRT2582922	hsa-miR-661	CLIP-seq
MIRT2582923	hsa-miR-668	CLIP-seq
MIRT2582924	hsa-miR-670	CLIP-seq
MIRT2284976	hsa-miR-759	CLIP-seq
MIRT2056493	hsa-miR-761	CLIP-seq
MIRT2056494	hsa-miR-770-5p	CLIP-seq
MIRT2056496	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
REST	Repression	16330548

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IMP	23639442
GO:0001525	Process	Angiogenesis	ISS	24401374
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	ISS	24401374
GO:0001570	Process	Vasculogenesis	IBA
GO:0001755	Process	Neural crest cell migration	IBA
GO:0001764	Process	Neuron migration	IEA
GO:0001764	Process	Neuron migration	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	TAS	21245381
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS	24401374
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	ISS
GO:0002116	Component	Semaphorin receptor complex	NAS	19909241
GO:0003148	Process	Outflow tract septum morphogenesis	IEA
GO:0003148	Process	Outflow tract septum morphogenesis	ISS
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IBA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IEA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	ISS
GO:0005021	Function	Vascular endothelial growth factor receptor activity	NAS	19909241
GO:0005021	Function	Vascular endothelial growth factor receptor activity	TAS	9288753
GO:0005096	Function	GTPase activator activity	IMP	26051942
GO:0005515	Function	Protein binding	IPI	16763549, 17222790, 19175293, 21653826, 22897854, 24021649, 24863063, 33000221, 33082294
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS	23639442
GO:0005829	Component	Cytosol	IDA	21245381
GO:0005883	Component	Neurofilament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21245381
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	24863063
GO:0005925	Component	Focal adhesion	IEA
GO:0006930	Process	Substrate-dependent cell migration, cell extension	IMP	24863063
GO:0007165	Process	Signal transduction	TAS	9288753
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24863063, 26051942
GO:0007267	Process	Cell-cell signaling	TAS	9288753
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	NAS	19909241
GO:0007411	Process	Axon guidance	TAS	9288753
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007507	Process	Heart development	IEA
GO:0008045	Process	Motor neuron axon guidance	IEA
GO:0008045	Process	Motor neuron axon guidance	ISS
GO:0008201	Function	Heparin binding	IEA
GO:0009611	Process	Response to wounding	IBA
GO:0009887	Process	Animal organ morphogenesis	TAS	9529250
GO:0010595	Process	Positive regulation of endothelial cell migration	IBA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	24863063
GO:0010595	Process	Positive regulation of endothelial cell migration	TAS	21245381
GO:0014911	Process	Positive regulation of smooth muscle cell migration	TAS	21245381
GO:0015026	Function	Coreceptor activity	TAS	21245381
GO:0016020	Component	Membrane	IEA
GO:0016358	Process	Dendrite development	IEA
GO:0017154	Function	Semaphorin receptor activity	IBA
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0017154	Function	Semaphorin receptor activity	NAS	19909241
GO:0019838	Function	Growth factor binding	IEA
GO:0019838	Function	Growth factor binding	IPI	9529250
GO:0019838	Function	Growth factor binding	TAS	21245381
GO:0019901	Function	Protein kinase binding	IEA
GO:0019955	Function	Cytokine binding	NAS	19909241
GO:0021612	Process	Facial nerve structural organization	IEA
GO:0021612	Process	Facial nerve structural organization	ISS
GO:0021636	Process	Trigeminal nerve morphogenesis	IEA
GO:0021637	Process	Trigeminal nerve structural organization	IEA
GO:0021637	Process	Trigeminal nerve structural organization	ISS
GO:0021649	Process	Vestibulocochlear nerve structural organization	IEA
GO:0021785	Process	Branchiomotor neuron axon guidance	IEA
GO:0021785	Process	Branchiomotor neuron axon guidance	ISS
GO:0021828	Process	Gonadotrophin-releasing hormone neuronal migration to the hypothalamus	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030517	Process	Negative regulation of axon extension	IEA
GO:0030947	Process	Regulation of vascular endothelial growth factor receptor signaling pathway	IBA
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	ISS
GO:0031410	Component	Cytoplasmic vesicle	TAS	21245381
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IMP	26051942
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IMP	21245381
GO:0035767	Process	Endothelial cell chemotaxis	IMP	21245381
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	ISS	24401374
GO:0036486	Process	Ventral trunk neural crest cell migration	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IEA
GO:0038085	Function	Vascular endothelial growth factor binding	IBA
GO:0038085	Function	Vascular endothelial growth factor binding	IEA
GO:0038085	Function	Vascular endothelial growth factor binding	IPI	24401374
GO:0038189	Process	Neuropilin signaling pathway	IEA
GO:0038189	Process	Neuropilin signaling pathway	IMP	24863063, 26051942
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	IEA
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	IMP	24863063
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	ISS	23639442
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS	22683681
GO:0043235	Component	Receptor complex	TAS	21245381
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0046718	Process	Symbiont entry into host cell	IDA	33000221, 33082294
GO:0046872	Function	Metal ion binding	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IMP	21245381
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	21245381
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IMP	21245381
GO:0048485	Process	Sympathetic nervous system development	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048675	Process	Axon extension	IEA
GO:0048841	Process	Regulation of axon extension involved in axon guidance	IEA
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	IEA
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	ISS
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS	23639442, 24401374
GO:0048846	Process	Axon extension involved in axon guidance	IEA
GO:0048846	Process	Axon extension involved in axon guidance	ISS
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050918	Process	Positive chemotaxis	ISS
GO:0051491	Process	Positive regulation of filopodium assembly	IBA
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IMP	26051942
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	26051942
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	24863063
GO:0060385	Process	Axonogenesis involved in innervation	IEA
GO:0060385	Process	Axonogenesis involved in innervation	ISS
GO:0060627	Process	Regulation of vesicle-mediated transport	TAS	21245381
GO:0060666	Process	Dichotomous subdivision of terminal units involved in salivary gland branching	IEA
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	IEA
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	ISS	24401374
GO:0060982	Process	Coronary artery morphogenesis	IEA
GO:0061298	Process	Retina vasculature development in camera-type eye	IEA
GO:0061299	Process	Retina vasculature morphogenesis in camera-type eye	IEA
GO:0061299	Process	Retina vasculature morphogenesis in camera-type eye	ISS	24401374
GO:0061441	Process	Renal artery morphogenesis	IEA
GO:0061549	Process	Sympathetic ganglion development	IEA
GO:0061549	Process	Sympathetic ganglion development	ISS
GO:0061551	Process	Trigeminal ganglion development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS	23639442
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0071526	Process	Semaphorin-plexin signaling pathway	NAS	19909241
GO:0071679	Process	Commissural neuron axon guidance	IEA
GO:0071679	Process	Commissural neuron axon guidance	ISS
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0097102	Process	Endothelial tip cell fate specification	ISS
GO:0097374	Process	Sensory neuron axon guidance	IEA
GO:0097443	Component	Sorting endosome	IEA
GO:0097443	Component	Sorting endosome	ISS	23639442
GO:0097475	Process	Motor neuron migration	IEA
GO:0097475	Process	Motor neuron migration	ISS
GO:0097490	Process	Sympathetic neuron projection extension	IEA
GO:0097490	Process	Sympathetic neuron projection extension	ISS
GO:0097491	Process	Sympathetic neuron projection guidance	IEA
GO:0097491	Process	Sympathetic neuron projection guidance	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099173	Process	Postsynapse organization	IEA
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	IEA
GO:0150018	Process	Basal dendrite development	IEA
GO:0150018	Process	Basal dendrite development	ISS	22683681
GO:0150020	Process	Basal dendrite arborization	IEA
GO:0150020	Process	Basal dendrite arborization	ISS	22683681
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	24863063
GO:1901166	Process	Neural crest cell migration involved in autonomic nervous system development	IEA
GO:1901166	Process	Neural crest cell migration involved in autonomic nervous system development	ISS
GO:1902946	Process	Protein localization to early endosome	IEA
GO:1902946	Process	Protein localization to early endosome	ISS	23639442
GO:1903375	Process	Facioacoustic ganglion development	IEA
GO:1904835	Process	Dorsal root ganglion morphogenesis	IEA
GO:1905040	Process	Otic placode development	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 602069
• HGNC: 8004
• e!Ensembl: ENSG00000099250

Protein

• UniProt ID: O14786
• Protein name: Neuropilin-1 (Vascular endothelial cell growth factor 165 receptor) (CD antigen CD304)
• Protein function: Cell-surface receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. Mediates the chemorepulsant activity of semaphorins (
• PDB: 1KEX, 2QQI, 2QQM, 2QQN, 3I97, 4DEQ, 4RN5, 5C7G, 5IJR, 5IYY, 5J1X, 5JGI, 5JGQ, 5JHK, 5L73, 6FMC, 6FMF, 6TKK, 7JJC, 7O1N, 7P5U, 8C5G, 8PFE, 9EOU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00431	CUB	27 → 138	CUB domain	Domain
  PF00431	CUB	147 → 262	CUB domain	Domain
  PF00754	F5_F8_type_C	290 → 421	F5/8 type C domain	Domain
  PF00754	F5_F8_type_C	446 → 580	F5/8 type C domain	Domain
  PF00629	MAM	650 → 810	MAM domain, meprin/A5/mu	Domain
  PF11980	DUF3481	842 → 923	C-terminal domain of neuropilin glycoprotein	Family

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: The expression of isoforms 1 and 2 does not seem to overlap. Expressed in olfactory epithelium (at protein level) (PubMed:33082293). Expressed in fibroblasts (at protein level) (PubMed:36213313). Expressed by the blood ves
• Sequence:

  MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
  PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
  IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVP
  KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
  GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
  WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
  DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
  VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
  INEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
  EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
  DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
  CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
  CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
  FEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD
  KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
  FELVDGVKLKKDKLNTQSTYSEA

• Sequence length: 923

Pathways

KEGG:

Axon guidance
Human T-cell leukemia virus 1 infection
Coronavirus disease - COVID-19

Reactome:

Neurophilin interactions with VEGF and VEGFR
Sema3A PAK dependent Axon repulsion
SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
CRMPs in Sema3A signaling
Signal transduction by L1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NRP1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	29018206		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	30378769		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21063027, 21978468, 22052678, 29200164, 29530508, 29693748		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15161648		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15867361		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15161648		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15867361		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17376520		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33937395	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21978468, 29200164, 29693748		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29632646		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	29212930		★☆☆☆☆ Found in Text Mining only
AMR Syndrome	Amr syndrome	Pubtator	38453145	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29773756, 30589468		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	35853630	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	18974107		★☆☆☆☆ Found in Text Mining only
Angiomatous Meningioma	Angiomatous Meningioma	BEFREE	23398358, 23651727		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27542226, 30027561, 30097486		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31740486		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	21921738	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22697500	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	29790686	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18292234, 22251373	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29790686		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27791986		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10974570, 11058875		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26627848	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31740486		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	24594544		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	25346392		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23913274		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29182645	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28257831		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	26877262	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24627131		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	25996847	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10974570, 15208678, 18981988, 25039617, 26951556		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37513474	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	10974570		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12216067, 17550303, 17875699, 20043119, 22885184, 25738638, 25772243, 26805761, 28468826, 28607365, 28887477, 29179185, 29728077, 29971782, 30022855, 30214235, 30241012, 30360368, 30587593, 30909144, 31106153		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12841681, 15203206, 17912247, 18715621, 18787945, 18922901, 21897119, 23981902, 28468826, 28607365, 29728077, 29971782, 30360368, 30909144, 32046779, 33884469, 34374639, 40343434	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31535669	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21401950, 30833579, 33177389	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35725010	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10519393		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28961428	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25997710, 26563279, 36376373	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24627131		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12412174, 12845630, 17699853, 29018205, 29138851, 31350404, 31417646		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26573160	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31880322, 33937395	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34212534	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26877262, 27666723, 33937395, 34168096	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17376520, 20195243, 25845525, 26573160		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29259233		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23816753		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30355201		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	23816753		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30362630, 31114235		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	31114235		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30362630, 31114235		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth disease, Type 2D	Charcot-Marie-Tooth disease	BEFREE	29520015		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21978468, 29200164, 29693748		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29632646		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28618167		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32801339	Associate	★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	33876574	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18403014		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23447383		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16361360		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31060904		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23913274		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15161648, 16773190, 19360289, 20950431		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22134529, 25351619, 29956750, 31420553		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20950431, 21401950, 28954991, 32139668, 33846300, 36193963, 36510452	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31802868		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28618167		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18974107, 29308313		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	35535576	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29111592		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23261523		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	23261523	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	18845325		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27598321		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27598321		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27598321, 34081912	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	38453145	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20053475, 25371288		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	27598321		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	10845581, 24093675		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	26877262	Stimulate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	24863063, 26923176		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18845325		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30806307		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30806307, 36199963, 36450534	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39387602	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20195243, 26573160		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30058693		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30058693		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30058693	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	26426212		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28887481, 31060904		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10974570, 12918061, 15208678, 18704117, 21842123, 28938007, 29088765, 29457830, 30479695		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18704117		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27879479, 32469390, 34843522, 36043525, 36595192, 37513474	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10974570, 15208678, 18704117, 21842123, 22134728, 28938007, 29088765, 29457830, 30479695		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12730958, 15160992		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15160992, 17369861, 21245381, 21842123, 26755653, 27481513, 29088765, 29097606, 29982104, 30479695, 31705924		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15160992, 21245381, 27385209, 38220212	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	31533337	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	35351150	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28835419, 31533337		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	19736548	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36362417	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36362417	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	36314791	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36965095	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29200164		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31883395	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	28667171		★☆☆☆☆ Found in Text Mining only
HETEROTAXY, VISCERAL, 2, AUTOSOMAL	Heterotaxy, Visceral	BEFREE	31704267		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	31282408	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30767669		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30118322		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	21059704		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18708346	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36376373, 36685583	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	31030100		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21353741		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	18815217		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	19762561	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	21401950	Associate	★☆☆☆☆ Found in Text Mining only
Jeune syndrome	Jeune syndrome	Pubtator	25996847	Associate	★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	21059704		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31282408		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19736548		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19736548	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	28835419		★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	29434931		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29411340	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18231921, 21063027		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18231921		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21063027, 30378769, 30614203	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15098140, 21063027, 24737589, 30378769, 31876105, 33054115, 33784904, 36965095	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12453880, 18231921, 21063027, 21978468, 24737589		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16990775		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	29212930		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29059194		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29873058		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20072992, 20971743, 21338642, 25333267, 25997710, 26563279, 29966621		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31060904		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20072992, 21338642		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10702410		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12845630, 26701889, 29138851, 34168096	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37679517	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	13130472, 22697500	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31533337		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31533337	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24999732, 27666723	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21063027, 31282408		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21063027, 31282408	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	31282408		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26426212, 33876574	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23261523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	30093598		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19505392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12216067, 17550303, 17875699, 20043119, 22885184, 25738638, 25772243, 26805761, 28468826, 28607365, 28887477, 29179185, 29728077, 29971782, 30022855, 30214235, 30241012, 30360368, 30587593, 30909144, 31106153		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30806307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30058693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11717452, 12845630, 17699853, 29018205, 29138851, 31350404, 31417646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24999732, 29873058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17010410, 17376520, 25845525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15867361, 20023433, 30027561, 31572065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	15956974		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14749471, 16322239, 20085644, 24066029, 24865426, 25338524, 28092670, 29304437		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12618892, 26795388, 29787985, 30841447, 31447585, 31572503		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24627131		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14500350, 17376520, 17699853, 19329879, 21842123, 22260660, 22614534, 23447383, 24397988, 24597503, 25845525, 26823738, 26916409, 28092670, 28466607, 28552348, 28618167, 29018205, 29097606, 29179185, 29632646, 29750423, 29755126, 29859925, 30116312, 30355201, 30456845, 30841447, 31009223, 31692439, 31744780		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30362630, 31114235		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15161648, 16773190, 19360289, 20950431		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12216067		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17550303, 25772243, 28607365		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29632646		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	37511358	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10886518, 11121133	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15166498, 23045606, 23685409, 26191184, 26406949, 26846845, 28977999, 31009223		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15166498		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25954957	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23261523		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23052042	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29549139		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	27322543		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	29671086		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	29671086	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34434074	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	17917967		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30100240		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24053763	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26755049		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10754495, 11058875, 12216067, 12618892, 15161648, 15867361, 16193833, 16211223, 17369861, 18086000, 18787945, 19329879, 19360289, 19826039, 20072992, 20195243, 20950431, 21338642, 21353741, 22693250, 23045606, 23185562, 23222303, 23401453, 23956271, 24627131, 24711126, 24916694, 25204970, 25333267, 25351619, 25458952, 25845525, 25912305, 26345913, 26755049, 26755653, 26795388, 26804176, 26832839, 26916409, 27083053, 27257039, 27542226, 27646474, 27798666, 27842858, 27940520, 28260064, 28414297, 28432397, 28466607, 28552348, 28607365, 28618167, 28738522, 28887477, 28938007, 28977999, 29018205, 29059172, 29097606, 29111348, 29138851, 29232521, 29334179, 29396568, 29730556, 29755126, 29859925, 29873058, 29966621, 30027561, 30097486, 30116312, 30245969, 30346764, 30355201, 30362630, 30420046, 30483904, 30514792, 30592418, 30628471, 30796053, 30807552, 30811684, 30954222, 31009223, 31060320, 31070356, 31114235, 31118303, 31143707, 31208428, 31346334, 31350177, 31350404, 31417646, 31432158, 31572065, 31676374, 31692439, 31740486		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	33000221, 33753480	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10974570, 11815985, 16193833, 20511222, 29750423, 30294852		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11815985, 34834998	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	12845630		★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	BEFREE	18160633		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12845630, 17699853, 25889301, 26823738, 29722179, 29777301, 30811684, 31521695		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12216067		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29471546		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29549139		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34903696, 39743445, 40428410	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36430655, 37140355	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24992616, 31539113		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31539113	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16211223, 17376520, 25845525		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31898520	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20023433, 30027561, 31572065		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26804176, 27542226, 27797376, 30027561		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14760080, 15956974, 17726369		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	15956974		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29107217		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12910515, 15476280, 15956974, 17568185, 32472711	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21653734, 30089122		★☆☆☆☆ Found in Text Mining only
Paragangliomas 3	Paraganglioma	Pubtator	37511358	Inhibit	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	30614203	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	26804176		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29457037		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31809209		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23585849	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	25109698		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29530508		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29530508		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21063027, 22052678, 29530508, 29693748		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	10845581		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14749471, 16322239, 18762808, 20085644, 24066029, 24865426, 25338524, 28092670, 29304437		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10754495, 28092670		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20085644, 24066029, 25990623, 28092670, 36124532, 36550208, 36841806	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	31320849		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29471546		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33334933	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34157565	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	19826039		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18974107, 29308313		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18974107		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32904674	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	20457980		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17015762, 22817681		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33334933	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	18086000		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28325756		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12845630, 16115696		★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	27598321		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23956271, 24791743, 24999732, 29873058		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29059172		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23563900, 24999732, 27666723, 37169211	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26877262	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30997315		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24999732, 27666723		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12618892, 26795388, 29787985, 30841447, 31447585, 31572503		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12618892, 30841447, 33661721, 33937395, 35036435, 35725010, 35831348, 37036489, 37702613, 39259065	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31430448		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	22251373	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26359450		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31282408		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	GWASDB_DG	23297363		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of Fallot	GWASCAT_DG	23297363		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	24594544, 29363855, 29432830		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	24594544, 29363855	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tongue Neoplasms	Tongue cancer	Pubtator	22926477	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28607365, 31676374		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28607365	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38169627	Associate	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	25713110		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24627131, 33937395	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18028372, 33987449, 35942212	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33170593	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	24594544		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	36157881	Associate	★☆☆☆☆ Found in Text Mining only