Gene Gene information from NCBI Gene database.
Entrez ID 8825
Gene name Lin-7 cell polarity scaffold A
Gene symbol LIN7A
Synonyms (NCBI Gene)
LIN-7ALIN7MALS-1MALS1TIP-33VELI1
Chromosome 12
Chromosome location 12q21.31
Summary The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a
miRNA miRNA information provided by mirtarbase database.
141
miRTarBase ID miRNA Experiments Reference
MIRT017177 hsa-miR-335-5p Microarray 18185580
MIRT022330 hsa-miR-124-3p Microarray 18668037
MIRT437380 hsa-miR-199a-5p Luciferase reporter assay 23201090
MIRT437380 hsa-miR-199a-5p Luciferase reporter assay 23201090
MIRT437380 hsa-miR-199a-5p Luciferase reporter assay 23201090
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11311936, 16688213, 16855024, 24366813, 25416956, 31515488, 32296183, 32707033, 33961781
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0005911 Component Cell-cell junction IBA
GO:0005923 Component Bicellular tight junction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603380 17787 ENSG00000111052
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14910
Protein name Protein lin-7 homolog A (Lin-7A) (hLin-7) (Mammalian lin-seven protein 1) (MALS-1) (Tax interaction protein 33) (TIP-33) (Vertebrate lin-7 homolog 1) (Veli-1)
Protein function Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins t
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02828 L27 29 82 L27 domain Domain
PF00595 PDZ 108 187 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, testis, kidney, placenta and liver. {ECO:0000269|PubMed:11311936}.
Sequence
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCP
EFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGF
NVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKD
SVKLVVR
YTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Sequence length 233
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Dopamine Neurotransmitter Release Cycle
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anaplastic carcinoma Anaplastic Carcinoma CTD_human_DG 12376462
★☆☆☆☆
Found in Text Mining only
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder BEFREE 18286632
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 26887652
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 26887652 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma CTD_human_DG 12376462
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 30537154
★☆☆☆☆
Found in Text Mining only
Carcinoma, Spindle-Cell Carcinoma CTD_human_DG 12376462
★☆☆☆☆
Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome Hereditary breast and ovarian cancer syndrome Pubtator 26887652 Associate
★☆☆☆☆
Found in Text Mining only
Huntington Disease Huntington Disease BEFREE 20720508
★☆☆☆☆
Found in Text Mining only
Hypoplasia of corpus callosum Hypoplasia Of Corpus Callosum BEFREE 24658322
★☆☆☆☆
Found in Text Mining only