Gene Gene information from NCBI Gene database.
Entrez ID 8812
Gene name Cyclin K
Gene symbol CCNK
Synonyms (NCBI Gene)
CPR4IDDHDF
Chromosome 14
Chromosome location 14q32.2
Summary The protein encoded by this gene is a member of the transcription cyclin family. These cyclins may regulate transcription through their association with and activation of cyclin-dependent kinases (CDK) that phosphorylate the C-terminal domain (CTD) of the
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1566748800 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
303
miRTarBase ID miRNA Experiments Reference
MIRT032200 hsa-let-7b-5p Proteomics 18668040
MIRT041776 hsa-miR-484 CLASH 23622248
MIRT038452 hsa-miR-296-3p CLASH 23622248
MIRT071718 hsa-miR-377-3p PAR-CLIP 21572407
MIRT071715 hsa-miR-181c-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity TAS 9632813
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IEA
GO:0002944 Component Cyclin K-CDK12 complex IPI 22012619, 26597175
GO:0002945 Component Cyclin K-CDK13 complex IPI 22012619, 26748711
GO:0004693 Function Cyclin-dependent protein serine/threonine kinase activity IDA 9632813
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603544 1596 ENSG00000090061
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75909
Protein name Cyclin-K
Protein function Regulatory subunit of cyclin-dependent kinases that mediates activation of target kinases. Plays a role in transcriptional regulation via its role in regulating the phosphorylation of the C-terminal domain (CTD) of the large subunit of RNA polym
PDB 2I53 , 4CXA , 4NST , 4UN0 , 5ACB , 5EFQ , 6B3E , 6CKX , 6TD3 , 7NXJ , 7NXK , 8BU1 , 8BU2 , 8BU3 , 8BU4 , 8BU5 , 8BU6 , 8BU7 , 8BU9 , 8BUA , 8BUB , 8BUC , 8BUD , 8BUE , 8BUF , 8BUG , 8BUH , 8BUI , 8BUJ , 8BUK , 8BUL , 8BUM , 8BUN , 8BUO , 8BUP , 8BUQ , 8BUR , 8BUS , 8BUT , 8P81 , 9FMR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 23 156 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 159 291 Cyclin, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highest levels in testis. {ECO:0000269|PubMed:9632813}.
Sequence
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQ
VEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQS
QPSQSSEPS
QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIET
THPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPP
NPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGL
PPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR
Sequence length 580
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Formation of RNA Pol II elongation complex
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA polymerase II transcribes snRNA genes
RNA Polymerase II Transcription Elongation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Intellectual developmental disorder with hypertelorism and distinctive facies Pathogenic rs1566748800 RCV000710289
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CCNK-related disorder Benign; Uncertain significance; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ataxia Telangiectasia Ataxia telangiectasia Pubtator 20930849 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 34289372 Associate
★☆☆☆☆
Found in Text Mining only
Congenital anomaly of face Facial dysmorphism BEFREE 30122539
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 11988847 Associate
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay HPO_DG
★☆☆☆☆
Found in Text Mining only
INTELLECTUAL DEVELOPMENTAL DISORDER WITH HYPERTELORISM AND DISTINCTIVE FACIES Intellectual Developmental Disorder With Hypertelorism And Distinctive Facies UNIPROT_DG 30122539
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukemia Leukemia Pubtator 37535603 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 24441149 Associate
★☆☆☆☆
Found in Text Mining only
Macrocephaly Macrocephaly HPO_DG
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 28670704
★☆☆☆☆
Found in Text Mining only