Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8808
Gene name	Interleukin 1 receptor like 2
Gene symbol	IL1RL2
Synonyms (NCBI Gene)	IL-1Rrp2IL-36RIL1R-rp2IL1RRP2
Chromosome	2
Chromosome location	2q12.1
Summary	The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437620	hsa-miR-146a-5p	MicroarrayqRT-PCR	22815788
MIRT437626	hsa-miR-146b-5p	MicroarrayqRT-PCR	22815788
MIRT570140	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT570139	hsa-miR-4267	PAR-CLIP	20371350
MIRT570138	hsa-miR-4301	PAR-CLIP	20371350
MIRT570137	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT570136	hsa-miR-6511a-3p	PAR-CLIP	20371350
MIRT570135	hsa-miR-6511b-3p	PAR-CLIP	20371350
MIRT570134	hsa-miR-6784-3p	PAR-CLIP	20371350
MIRT570133	hsa-miR-6862-3p	PAR-CLIP	20371350
MIRT570132	hsa-miR-591	PAR-CLIP	20371350
MIRT570131	hsa-miR-1229-3p	PAR-CLIP	20371350
MIRT570140	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT570139	hsa-miR-4267	PAR-CLIP	20371350
MIRT570138	hsa-miR-4301	PAR-CLIP	20371350
MIRT570137	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT570136	hsa-miR-6511a-3p	PAR-CLIP	20371350
MIRT570135	hsa-miR-6511b-3p	PAR-CLIP	20371350
MIRT570134	hsa-miR-6784-3p	PAR-CLIP	20371350
MIRT570133	hsa-miR-6862-3p	PAR-CLIP	20371350
MIRT570132	hsa-miR-591	PAR-CLIP	20371350
MIRT570131	hsa-miR-1229-3p	PAR-CLIP	20371350

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004908	Function	Interleukin-1 receptor activity	IEA
GO:0004908	Function	Interleukin-1 receptor activity	TAS	1833184
GO:0004909	Function	Interleukin-1, type I, activating receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	1833184
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006968	Process	Cellular defense response	TAS	8332913
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1833184
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
604512	5999	ENSG00000115598

Q9HB29

Protein name

Interleukin-1 receptor-like 2 (EC 3.2.2.6) (IL-36 receptor) (IL-36R) (Interleukin-1 receptor-related protein 2) (IL-1Rrp2) (IL1R-rp2)

Protein function

Receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and ot

PDB

6U6U , 9ETH , 9ETI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18452	Ig_6	70 → 117	Immunoglobulin domain	Domain
PF13895	Ig_2	125 → 214	Immunoglobulin domain	Domain
PF01582	TIR	385 → 575	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in synovial fibroblasts and articular chondrocytes. Expressed in keratinocytes and monocyte-derived dendritic cells. Expressed in monocytes and myeloid dendritic cells; at protein level. {ECO:0000269|PubMed:16646978, ECO:0000

Sequence

MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT
SIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL
LVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ
LGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK
IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDG
MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR
CRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG

Sequence length

575

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Interleukin-38 signaling Interleukin-36 pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Ascending aortic dissection	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION, ASCENDING AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30831444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	35325069	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32601180	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31387327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	24898045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26783184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36482185, 36890467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	29274415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31068441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29120743, 30417427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	23834760, 28726542, 29565192, 30230584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31455667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28975626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27853811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26813344, 28327619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29120743, 30417427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29241623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26516833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29274415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28099250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	30417427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11466363, 28602023, 28967976, 29176319, 29565192, 29744290, 31284527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27185339, 33804147, 38162658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustular psoriasis	Pustular Psoriasis	BEFREE	27783881, 28967976, 29422292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25902739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	40349828	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28327619		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL1RL2 (interleukin 1 receptor like 2)