TRIM24 (tripartite motif containing 24)

Gene

• Entrez ID: 8805
• Gene name: Tripartite motif containing 24
• Gene symbol: TRIM24
• Synonyms (NCBI Gene): PTC6, RNF82, TF1A, TIF1, TIF1A, TIF1ALPHA, hTIF1
• Chromosome: 7
• Chromosome location: 7q33-q34
• Summary: The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020969	hsa-miR-155-5p	Proteomics	20584899
MIRT024015	hsa-miR-1-3p	Proteomics	18668040
MIRT032466	hsa-let-7b-5p	Proteomics	18668040
MIRT032466	hsa-let-7b-5p	CLASH	23622248
MIRT509398	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT509397	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT509396	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509395	hsa-miR-5095	PAR-CLIP	23446348
MIRT509394	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509393	hsa-miR-2355-5p	PAR-CLIP	23446348
MIRT509392	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT495400	hsa-miR-6835-3p	PAR-CLIP	23708386
MIRT495398	hsa-miR-330-3p	PAR-CLIP	23708386
MIRT495399	hsa-miR-548aa	PAR-CLIP	23708386
MIRT495397	hsa-miR-548ap-3p	PAR-CLIP	23708386
MIRT495396	hsa-miR-548t-3p	PAR-CLIP	23708386
MIRT495395	hsa-miR-548as-3p	PAR-CLIP	23708386
MIRT495394	hsa-miR-548at-3p	PAR-CLIP	23708386
MIRT495393	hsa-miR-548ay-3p	PAR-CLIP	23708386
MIRT495392	hsa-miR-548at-5p	PAR-CLIP	23708386
MIRT378711	hsa-miR-4477a	PAR-CLIP	23708386
MIRT509398	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT509397	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT509396	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509395	hsa-miR-5095	PAR-CLIP	23446348
MIRT509394	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509393	hsa-miR-2355-5p	PAR-CLIP	23446348
MIRT509392	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT495400	hsa-miR-6835-3p	PAR-CLIP	23708386
MIRT495398	hsa-miR-330-3p	PAR-CLIP	23708386
MIRT495399	hsa-miR-548aa	PAR-CLIP	23708386
MIRT495397	hsa-miR-548ap-3p	PAR-CLIP	23708386
MIRT495396	hsa-miR-548t-3p	PAR-CLIP	23708386
MIRT495395	hsa-miR-548as-3p	PAR-CLIP	23708386
MIRT495394	hsa-miR-548at-3p	PAR-CLIP	23708386
MIRT495393	hsa-miR-548ay-3p	PAR-CLIP	23708386
MIRT495392	hsa-miR-548at-5p	PAR-CLIP	23708386
MIRT378711	hsa-miR-4477a	PAR-CLIP	23708386
MIRT2135871	hsa-miR-1305	CLIP-seq
MIRT2135872	hsa-miR-4659a-3p	CLIP-seq
MIRT2135873	hsa-miR-4659b-3p	CLIP-seq
MIRT2135874	hsa-miR-4680-3p	CLIP-seq
MIRT2135875	hsa-miR-580	CLIP-seq
MIRT2135875	hsa-miR-580	CLIP-seq
MIRT2356957	hsa-miR-587	CLIP-seq
MIRT2356958	hsa-miR-101	CLIP-seq
MIRT2356959	hsa-miR-1279	CLIP-seq
MIRT2356960	hsa-miR-139-5p	CLIP-seq
MIRT2356961	hsa-miR-140-5p	CLIP-seq
MIRT2356962	hsa-miR-144	CLIP-seq
MIRT2356963	hsa-miR-1972	CLIP-seq
MIRT2356964	hsa-miR-320a	CLIP-seq
MIRT2356965	hsa-miR-320b	CLIP-seq
MIRT2356966	hsa-miR-320c	CLIP-seq
MIRT2356967	hsa-miR-320d	CLIP-seq
MIRT2356968	hsa-miR-34c-3p	CLIP-seq
MIRT2356969	hsa-miR-3545-5p	CLIP-seq
MIRT2356970	hsa-miR-4429	CLIP-seq
MIRT2356971	hsa-miR-4460	CLIP-seq
MIRT2356972	hsa-miR-4509	CLIP-seq
MIRT2356973	hsa-miR-4650-5p	CLIP-seq
MIRT2356974	hsa-miR-4744	CLIP-seq
MIRT2356975	hsa-miR-4760-3p	CLIP-seq
MIRT2356976	hsa-miR-483-3p	CLIP-seq
MIRT2356958	hsa-miR-101	CLIP-seq
MIRT2356962	hsa-miR-144	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000791	Component	Euchromatin	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0002039	Function	P53 binding	IEA
GO:0002039	Function	P53 binding	IPI	19556538
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	21164480
GO:0003682	Function	Chromatin binding	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	21164480
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	TAS	9115274
GO:0004672	Function	Protein kinase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9115274
GO:0005515	Function	Protein binding	IPI	19556538, 19909775, 21164480, 21182203, 21531907, 24981860, 26496610, 35271311
GO:0005634	Component	Nucleus	IDA	21164480, 25593309
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9115274
GO:0005654	Component	Nucleoplasm	IDA
GO:0005726	Component	Perichromatin fibrils	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9115274
GO:0008270	Function	Zinc ion binding	IDA	21164480
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IDA	19556538
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030163	Process	Protein catabolic process	IMP	19556538
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	IMP	19556538
GO:0031981	Component	Nuclear lumen	IEA
GO:0034056	Function	Estrogen response element binding	IDA	21164480
GO:0042981	Process	Regulation of apoptotic process	IMP	19556538
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	19556538
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070562	Process	Regulation of vitamin D receptor signaling pathway	IEA
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	21164480
GO:0140118	Function	Histone H3K23ac reader activity	IDA	21164480
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IEA

Other IDs

• MIM: 603406
• HGNC: 11812
• e!Ensembl: ENSG00000122779

Protein

• UniProt ID: O15164
• Protein name: Transcription intermediary factor 1-alpha (TIF1-alpha) (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRIM24) (RING finger protein 82) (RING-type E3 ubiquitin transferase TIF1-alpha) (Tripartite motif-containing protein 24)
• Protein function: Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone
• PDB: 2YYN, 3O33, 3O34, 3O35, 3O36, 3O37, 4YAB, 4YAD, 4YAT, 4YAX, 4YBM, 4YBS, 4YBT, 4YC9, 4ZQL, 5H1T, 5H1U, 5H1V, 7B9X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00643	zf-B_box	218 → 259	B-box zinc finger	Domain
  PF00628	PHD	828 → 873	PHD-finger	Domain
  PF00439	Bromodomain	908 → 992	Bromodomain	Domain

• Sequence:

  MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
  QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
  QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
  EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
  LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
  NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
  HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
  GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
  RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
  PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
  GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
  PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
  RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
  DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
  CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
  TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
  KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
  DNKFSDDSDDDFVQPRKKRLKSIEERQLLK

• Sequence length: 1050

Pathways

Reactome:

Signaling by cytosolic FGFR1 fusion mutants
Signaling by FGFR1 in disease
Signaling by BRAF and RAF fusions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Ovarian cancer	Likely pathogenic	rs762354802	RCV003154759	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFERENTIATED THYROID CARCINOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS, CASTRATION-RESISTANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIM24-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	29507391		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22897724		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22897724		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30398003, 30535395		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37301411	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	40774983	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25846736		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34886858	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	24469053		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21164480, 21435435, 25065590		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21164480, 25974391, 27638829	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21435435	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21435435, 25700357, 25846736, 35332266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29129908	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24409330, 35332266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25846736		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30092841		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33173411	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28337289		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28337289		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22897724		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25700357, 28916426		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25700357, 33300060	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30398003, 30535395		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32252809	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30398003		★☆☆☆☆ Found in Text Mining only
Differentiated thyroid carcinoma	Thyroid Carcinoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	24469053, 29129908		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29129908, 32492707, 34886858	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24469053, 29129908		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24469053, 29129908		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	24304929	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11986951		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	18026104		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24409330, 25281858, 29627320		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29627320		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22666376	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27689360	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28337289		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29862279, 31858531	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24469053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21164480, 21435435, 25065590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21768647		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30092841		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27238081, 30479348, 30867828, 31178279, 31217891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25724180, 28114950, 28454326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25846736		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24469053, 27300431, 29149307, 30535395, 30867828, 30992170, 31279808		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28337289		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21435435		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24345920, 25572314	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25572314		★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	9024215		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	29149307, 30016492		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	30398003		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29749443		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	38129408	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10589759, 23717505, 24409330, 24469053, 25065590, 25281858, 28454326, 28916426, 29149307, 29627320, 31178279, 31217891		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10094499		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25281858		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22666376		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25281858		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30867828		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31858531	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	10439047		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	ORPHANET_DG	10439047, 17062879		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27238081, 30479348, 30867828, 31178279, 31217891		★☆☆☆☆ Found in Text Mining only
Prostatic Cancer, Castration-Resistant	Prostatic Cancer, Castration-Resistant	CTD_human_DG	27238081		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27300431, 30479348	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms, Castration-Resistant	Prostatic Neoplasms, Castration-Resistant	CTD_human_DG	27238081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Disease	Raynaud disease	Pubtator	36996276	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27689360		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23717505, 28061796, 29862279	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23717505, 28061796, 29862279		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25281858		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25724180, 28114950, 28454326		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28114950	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28402931	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32737449	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25846736	Stimulate	★☆☆☆☆ Found in Text Mining only