Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8797
Gene name	TNF receptor superfamily member 10a
Gene symbol	TNFRSF10A
Synonyms (NCBI Gene)	APO2CD261DR4TRAILR-1TRAILR1
Chromosome	8
Chromosome location	8p21.3
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies

161

Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001494	hsa-miR-155-5p	pSILAC	18668040
MIRT001494	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT031670	hsa-miR-16-5p	Proteomics	18668040
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT665121	hsa-miR-4297	HITS-CLIP	23824327
MIRT665120	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561187	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT561186	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561184	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT665121	hsa-miR-4297	HITS-CLIP	23824327
MIRT665120	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561187	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT561186	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561184	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT1442537	hsa-miR-106a	CLIP-seq
MIRT1442538	hsa-miR-106b	CLIP-seq
MIRT1442539	hsa-miR-1245	CLIP-seq
MIRT1442540	hsa-miR-150	CLIP-seq
MIRT1442541	hsa-miR-17	CLIP-seq
MIRT1442542	hsa-miR-20a	CLIP-seq
MIRT1442543	hsa-miR-20b	CLIP-seq
MIRT1442544	hsa-miR-302a	CLIP-seq
MIRT1442545	hsa-miR-302b	CLIP-seq
MIRT1442546	hsa-miR-302c	CLIP-seq
MIRT1442547	hsa-miR-302d	CLIP-seq
MIRT1442548	hsa-miR-302e	CLIP-seq
MIRT1442549	hsa-miR-3545-3p	CLIP-seq
MIRT1442550	hsa-miR-3663-5p	CLIP-seq
MIRT1442551	hsa-miR-372	CLIP-seq
MIRT1442552	hsa-miR-373	CLIP-seq
MIRT1442553	hsa-miR-4256	CLIP-seq
MIRT1442554	hsa-miR-4635	CLIP-seq
MIRT1442555	hsa-miR-4731-5p	CLIP-seq
MIRT1442556	hsa-miR-512-3p	CLIP-seq
MIRT1442557	hsa-miR-519d	CLIP-seq
MIRT1442558	hsa-miR-520a-3p	CLIP-seq
MIRT1442559	hsa-miR-520b	CLIP-seq
MIRT1442560	hsa-miR-520c-3p	CLIP-seq
MIRT1442561	hsa-miR-520d-3p	CLIP-seq
MIRT1442562	hsa-miR-520e	CLIP-seq
MIRT1442563	hsa-miR-520g	CLIP-seq
MIRT1442564	hsa-miR-520h	CLIP-seq
MIRT1442565	hsa-miR-640	CLIP-seq
MIRT1442566	hsa-miR-93	CLIP-seq
MIRT1442537	hsa-miR-106a	CLIP-seq
MIRT1442538	hsa-miR-106b	CLIP-seq
MIRT1442539	hsa-miR-1245	CLIP-seq
MIRT1442540	hsa-miR-150	CLIP-seq
MIRT1442541	hsa-miR-17	CLIP-seq
MIRT1442542	hsa-miR-20a	CLIP-seq
MIRT1442543	hsa-miR-20b	CLIP-seq
MIRT1442544	hsa-miR-302a	CLIP-seq
MIRT1442545	hsa-miR-302b	CLIP-seq
MIRT1442546	hsa-miR-302c	CLIP-seq
MIRT1442547	hsa-miR-302d	CLIP-seq
MIRT1442548	hsa-miR-302e	CLIP-seq
MIRT1442549	hsa-miR-3545-3p	CLIP-seq
MIRT1442551	hsa-miR-372	CLIP-seq
MIRT1442552	hsa-miR-373	CLIP-seq
MIRT1442553	hsa-miR-4256	CLIP-seq
MIRT2132487	hsa-miR-4438	CLIP-seq
MIRT1442554	hsa-miR-4635	CLIP-seq
MIRT2132488	hsa-miR-5095	CLIP-seq
MIRT1442556	hsa-miR-512-3p	CLIP-seq
MIRT1442557	hsa-miR-519d	CLIP-seq
MIRT1442558	hsa-miR-520a-3p	CLIP-seq
MIRT1442559	hsa-miR-520b	CLIP-seq
MIRT1442560	hsa-miR-520c-3p	CLIP-seq
MIRT1442561	hsa-miR-520d-3p	CLIP-seq
MIRT1442562	hsa-miR-520e	CLIP-seq
MIRT1442563	hsa-miR-520g	CLIP-seq
MIRT1442564	hsa-miR-520h	CLIP-seq
MIRT1442565	hsa-miR-640	CLIP-seq
MIRT1442566	hsa-miR-93	CLIP-seq
MIRT1442537	hsa-miR-106a	CLIP-seq
MIRT1442538	hsa-miR-106b	CLIP-seq
MIRT1442539	hsa-miR-1245	CLIP-seq
MIRT1442540	hsa-miR-150	CLIP-seq
MIRT1442541	hsa-miR-17	CLIP-seq
MIRT1442542	hsa-miR-20a	CLIP-seq
MIRT1442543	hsa-miR-20b	CLIP-seq
MIRT1442544	hsa-miR-302a	CLIP-seq
MIRT1442545	hsa-miR-302b	CLIP-seq
MIRT1442546	hsa-miR-302c	CLIP-seq
MIRT1442547	hsa-miR-302d	CLIP-seq
MIRT1442548	hsa-miR-302e	CLIP-seq
MIRT1442551	hsa-miR-372	CLIP-seq
MIRT1442552	hsa-miR-373	CLIP-seq
MIRT2132487	hsa-miR-4438	CLIP-seq
MIRT1442555	hsa-miR-4731-5p	CLIP-seq
MIRT2132488	hsa-miR-5095	CLIP-seq
MIRT1442556	hsa-miR-512-3p	CLIP-seq
MIRT1442557	hsa-miR-519d	CLIP-seq
MIRT1442558	hsa-miR-520a-3p	CLIP-seq
MIRT1442559	hsa-miR-520b	CLIP-seq
MIRT1442560	hsa-miR-520c-3p	CLIP-seq
MIRT1442561	hsa-miR-520d-3p	CLIP-seq
MIRT1442562	hsa-miR-520e	CLIP-seq
MIRT1442563	hsa-miR-520g	CLIP-seq
MIRT1442564	hsa-miR-520h	CLIP-seq
MIRT1442565	hsa-miR-640	CLIP-seq
MIRT1442566	hsa-miR-93	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
HDAC1	Unknown	18408217
JUN	Unknown	12082627
NFKB1	Unknown	21243522
RELA	Unknown	21243522
TP53	Activation	11313989

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	21785459
GO:0005035	Function	Death receptor activity	IEA
GO:0005035	Function	Death receptor activity	TAS	9082980
GO:0005515	Function	Protein binding	IPI	17047155, 18165900, 18846110, 19427028, 20103630, 21785459, 30833792, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	22240897
GO:0005829	Component	Cytosol	IDA	22240897
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22240897
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	NAS	9311998
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9082980
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	NAS	9430227, 11464292
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	NAS	9311998
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	9082980
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	22952982
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IBA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	9430228
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IEA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IMP	19090789
GO:0038023	Function	Signaling receptor activity	NAS	9311998, 19090789
GO:0042802	Function	Identical protein binding	IDA	19090789
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0044853	Component	Plasma membrane raft	IDA	19090789
GO:0045121	Component	Membrane raft	IDA	19090789
GO:0045121	Component	Membrane raft	IEA
GO:0045569	Function	TRAIL binding	IEA
GO:0045569	Function	TRAIL binding	NAS	9373179
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459

MIM	HGNC	e!Ensembl
603611	11904	ENSG00000104689

O00220

Protein name

Tumor necrosis factor receptor superfamily member 10A (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor 1) (TRAIL-R1) (CD antigen CD261)

Protein function

Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:26457518, PubMed:38532423). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic acti

PDB

5CIR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	148 → 188	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	190 → 229	TNFR/NGFR cysteine-rich region	Domain
PF00531	Death	367 → 448	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.

Sequence

MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE

Sequence length

468

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor p53 signaling pathway Apoptosis Necroptosis Natural killer cell mediated cytotoxicity Pathogenic Escherichia coli infection Salmonella infection Influenza A Lipid and atherosclerosis		Caspase activation via Death Receptors in the presence of ligand Cell surface interactions at the vascular wall Regulation by c-FLIP RIPK1-mediated regulated necrosis CASP8 activity is inhibited TP53 Regulates Transcription of Death Receptors and Ligands Dimerization of procaspase-8 TRAIL signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAUSEA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (180)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15921376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20673328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18305945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15911244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19148581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15650163, 16195335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21909106, 23868022, 24235014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	CTD_human_DG	21909106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22695614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	16110259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	19706813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	19652058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31094932		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26708505, 27492861, 30064384, 30366420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	19652058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	10527388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19171073	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20799941, 21305500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	22480748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19706813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31161422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16051735, 25951128		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16051735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12649168, 16217763, 19070628, 21700414, 25955868, 29446085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12649168, 16217763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11431320, 12385006, 15354201, 15975957, 16033835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19074831, 22411600, 22909995, 37116152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	10762627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19959214, 35721888, 36068491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15911244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22401174, 24209510, 33059309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12649168, 16217763, 19070628, 21700414, 25955868, 29446085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19203830, 23661154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27053682, 30064384, 40424767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12771998, 33000263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15863153, 21484799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17689412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19148581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21953056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27978543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14614459, 15861184, 16217763, 16357130, 21699383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27721019, 30160785, 30947287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11875499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17075118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	17075118		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17035413, 17148761, 19424623, 20673328, 23284732, 26518902, 26520390, 29137287, 29446085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17035413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18590575, 18755584, 20673328, 22389673, 23284732, 23732517, 29278689, 34342264, 35159257, 35721888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11139287, 27879498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	29626752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	7827377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	27006531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	27006531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	12136286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21472143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	11289151, 11423911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24587306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28881598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16544055, 19706813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16544055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36972629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16544055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10980594, 19706813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	9613612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26718429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35945262	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18043245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	18203008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24136227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22401174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	22202031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	22891927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	24946908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	29472772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25605161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16891471		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18203008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21070598, 22183068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15921376, 21070598, 29472772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15921376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	23050498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12085986, 12632104, 15254777, 20014456, 22401174, 28410209, 28975649, 30945308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21146890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	23050498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23661154, 25770212, 34282054, 37192591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15531454	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	LHGDN	18203008		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	23306613, 23959437		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular	Lymphoma	BEFREE	27977511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11313970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11313970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26854823, 31872073	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	9613612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26718429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	16217763, 16357130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	16217763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11431320, 12385006, 15354201, 15975957, 16033835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22401174, 28119237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19203830, 23661154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	10762627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15863153, 21484799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25482930, 27053682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12907654, 16217763, 17431115, 18163425, 25691252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16012731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12649168, 16217763, 19070628, 21700414, 25955868, 29446085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10762627, 15911244, 15975957, 16357130, 16502485, 16951164, 17035413, 18163425, 18209050, 18645026, 18813321, 19350268, 19643596, 20354842, 20605676 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	17075118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27721019, 30160785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12385006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15975957, 19074831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16217763, 16357130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	25833810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19148581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19148581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16297203, 16778114, 17070520, 17545621, 18222423, 21268068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16778114, 26134947		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17160022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26240495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	15334061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17953743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31775645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12531793, 16638930, 18209050, 22389670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18209050, 22389670, 23423784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21814551	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21814551, 31161422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25736057		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15802890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15802890		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	15237707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10762627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11289151, 11313970, 11733907, 12085234, 12385006, 12632104, 15863153, 15975957, 16051735, 16217763, 16544055, 17035413, 17479107, 18163425, 20087343 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	CTD_human_DG	19652058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	14999771, 20041491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20041491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15863153, 21484799		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15972852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15972852, 19959214, 23634944, 32332713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14583775, 25482930, 27053682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23392805, 30064384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23460812, 26138346, 27053682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	12808117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	12808117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29312559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	19652058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	12907654, 16217763, 17431115, 18163425, 25691252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12878867, 25691252	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16217763, 18163425		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudopelade	Pseudopelade	CTD_human_DG	19652058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29547942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11139287, 21255579, 27879498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	26851238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	2001978, 22480748, 2510739, 8162639, 8894643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	22480748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	22258765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16217763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17592646, 25605161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16217763, 22513214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16012731, 19350268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31673231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33297339, 35631261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20430723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	31161422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	31161422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	7906684		★★★★★ ★☆☆☆☆ Found in Text Mining only

TNFRSF10A (TNF receptor superfamily member 10a)