TNFRSF10C (TNF receptor superfamily member 10c)

Gene

• Entrez ID: 8794
• Gene name: TNF receptor superfamily member 10c
• Gene symbol: TNFRSF10C
• Synonyms (NCBI Gene): CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT1442774	hsa-miR-1292	CLIP-seq
MIRT1442775	hsa-miR-1321	CLIP-seq
MIRT1442776	hsa-miR-1827	CLIP-seq
MIRT1442777	hsa-miR-1909	CLIP-seq
MIRT1442778	hsa-miR-2467-3p	CLIP-seq
MIRT1442779	hsa-miR-3126-5p	CLIP-seq
MIRT1442780	hsa-miR-3199	CLIP-seq
MIRT1442781	hsa-miR-3612	CLIP-seq
MIRT1442782	hsa-miR-361-3p	CLIP-seq
MIRT1442783	hsa-miR-4260	CLIP-seq
MIRT1442784	hsa-miR-4267	CLIP-seq
MIRT1442785	hsa-miR-4419a	CLIP-seq
MIRT1442786	hsa-miR-4436b-3p	CLIP-seq
MIRT1442787	hsa-miR-4471	CLIP-seq
MIRT1442788	hsa-miR-4510	CLIP-seq
MIRT1442789	hsa-miR-4648	CLIP-seq
MIRT1442790	hsa-miR-4654	CLIP-seq
MIRT1442791	hsa-miR-4688	CLIP-seq
MIRT1442792	hsa-miR-4733-3p	CLIP-seq
MIRT1442793	hsa-miR-4739	CLIP-seq
MIRT1442794	hsa-miR-4740-5p	CLIP-seq
MIRT1442795	hsa-miR-4756-5p	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442797	hsa-miR-4768-3p	CLIP-seq
MIRT1442798	hsa-miR-4769-5p	CLIP-seq
MIRT1442799	hsa-miR-486-3p	CLIP-seq
MIRT1442800	hsa-miR-650	CLIP-seq
MIRT1442801	hsa-miR-665	CLIP-seq
MIRT1442802	hsa-miR-922	CLIP-seq
MIRT1442803	hsa-miR-940	CLIP-seq
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT1442774	hsa-miR-1292	CLIP-seq
MIRT2132513	hsa-miR-3120-5p	CLIP-seq
MIRT1442787	hsa-miR-4471	CLIP-seq
MIRT1442789	hsa-miR-4648	CLIP-seq
MIRT1442790	hsa-miR-4654	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442798	hsa-miR-4769-5p	CLIP-seq
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT2693662	hsa-miR-1254	CLIP-seq
MIRT2693663	hsa-miR-1291	CLIP-seq
MIRT1442775	hsa-miR-1321	CLIP-seq
MIRT1442776	hsa-miR-1827	CLIP-seq
MIRT2693664	hsa-miR-193a-3p	CLIP-seq
MIRT2693665	hsa-miR-193b	CLIP-seq
MIRT1442778	hsa-miR-2467-3p	CLIP-seq
MIRT2693666	hsa-miR-2861	CLIP-seq
MIRT2693667	hsa-miR-3064-5p	CLIP-seq
MIRT2693668	hsa-miR-3116	CLIP-seq
MIRT2693669	hsa-miR-3173-5p	CLIP-seq
MIRT2693670	hsa-miR-328	CLIP-seq
MIRT1442781	hsa-miR-3612	CLIP-seq
MIRT2693671	hsa-miR-3652	CLIP-seq
MIRT2693672	hsa-miR-3689a-3p	CLIP-seq
MIRT2693673	hsa-miR-3689c	CLIP-seq
MIRT2693674	hsa-miR-3928	CLIP-seq
MIRT2693675	hsa-miR-4290	CLIP-seq
MIRT2693676	hsa-miR-4313	CLIP-seq
MIRT2693677	hsa-miR-432	CLIP-seq
MIRT1442785	hsa-miR-4419a	CLIP-seq
MIRT2693678	hsa-miR-4426	CLIP-seq
MIRT2693679	hsa-miR-4430	CLIP-seq
MIRT1442786	hsa-miR-4436b-3p	CLIP-seq
MIRT2693680	hsa-miR-4505	CLIP-seq
MIRT1442788	hsa-miR-4510	CLIP-seq
MIRT2693681	hsa-miR-4647	CLIP-seq
MIRT2693682	hsa-miR-4662b	CLIP-seq
MIRT2693683	hsa-miR-4699-5p	CLIP-seq
MIRT2693684	hsa-miR-4728-5p	CLIP-seq
MIRT1442793	hsa-miR-4739	CLIP-seq
MIRT1442795	hsa-miR-4756-5p	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442800	hsa-miR-650	CLIP-seq
MIRT2693685	hsa-miR-661	CLIP-seq
MIRT1442802	hsa-miR-922	CLIP-seq
MIRT1442803	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9314565
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9314565
GO:0006915	Process	Apoptotic process	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0045569	Function	TRAIL binding	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 603613
• HGNC: 11906
• e!Ensembl: ENSG00000173535

Protein

• UniProt ID: O14798
• Protein name: Tumor necrosis factor receptor superfamily member 10C (Antagonist decoy receptor for TRAIL/Apo-2L) (Decoy TRAIL receptor without death domain) (Decoy receptor 1) (DcR1) (Lymphocyte inhibitor of TRAIL) (TNF-related apoptosis-inducing ligand receptor 3) (TR
• Protein function: Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	69 → 109	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	111 → 149	TNFR/NGFR cysteine-rich region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
• Sequence:

  MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
  EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
  SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
  ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY
  LSCTIVGIIVLIVLLIVFV

• Sequence length: 259

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor

Reactome:

TP53 Regulates Transcription of Death Receptors and Ligands

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15921376		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19435948		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14613271, 20799941	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22159596, 28420351, 30616060		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14623878, 21092294, 24218337, 28420351	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	23584885	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20676325	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17569106	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14999791, 22555108		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14999791, 26542757		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14999791, 26542757		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11753607		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27532455		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	25056994		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25056994	Associate	★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	17265502		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16856205	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36646765	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18590575, 18755584, 33779485, 34541005	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21448164		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	7999986		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18942021		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18942021	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18057577	Stimulate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15520513, 16303751, 9299242		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	9299242		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19936781		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	23584885, 24649804	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24649804	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	17265502		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	LHGDN	17265502		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	16616114, 19446744		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23320456, 27748795		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23320456, 27748795		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11221847, 25808868, 9613612		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	9299242		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	22891927		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	30106292		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	15520513, 16303751, 7999986		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21281967	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21281967	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15921376		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15921376		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	15001474		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14606071		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15001474		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22159596, 28420351, 30616060		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11848467, 21269942, 26840266		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14999791, 19035483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14623878, 19035483		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14999791, 26542757		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14623878		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15916713		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10754286, 24211571, 24762620		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24762620	Associate	★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	15520513, 16303751, 7999986		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11495702	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14999791		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21814551		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11698291		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10435597, 11929838, 14999791, 17569106, 19035483, 20564325, 21269942, 22555108, 23320456, 24573469, 28043144, 28420351		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11929838, 17570703		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	15001474		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28043144		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40165145	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14999791, 22555108		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32629664	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11848467, 21269942, 26840266		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22629410	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	12808117	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	12808117		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28850112		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14999791, 19035483		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18460741, 19035483		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18460741	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19035483		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19035483	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28968978		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17592646	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31399243		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30197187		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17894941	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	24211571		★☆☆☆☆ Found in Text Mining only