Gene Gene information from NCBI Gene database.
Entrez ID 8773
Gene name Synaptosome associated protein 23
Gene symbol SNAP23
Synonyms (NCBI Gene)
HsT17016SNAP-23SNAP23ASNAP23B
Chromosome 15
Chromosome location 15q15.1-q15.2
Summary Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-a
miRNA miRNA information provided by mirtarbase database.
590
miRTarBase ID miRNA Experiments Reference
MIRT001590 hsa-let-7b-5p pSILAC 18668040
MIRT023206 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT025561 hsa-miR-34a-5p Proteomics 21566225
MIRT027856 hsa-miR-98-5p Microarray 19088304
MIRT001590 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0002553 Process Histamine secretion by mast cell IMP 18253931
GO:0005484 Function SNAP receptor activity IBA
GO:0005515 Function Protein binding IPI 12773094, 16189514, 21900206, 24373201, 24705354, 25416956, 26359495, 30833792, 32296183, 33961781, 35271311
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 18457912
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602534 11131 ENSG00000092531
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00161
Protein name Synaptosomal-associated protein 23 (SNAP-23) (Vesicle-membrane fusion protein SNAP-23)
Protein function Essential component of the high affinity receptor for the general membrane fusion machinery and an important regulator of transport vesicle docking and fusion.
PDB 1NHL , 3ZUS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00835 SNAP-25 86 147 SNAP-25 family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest levels where found in placenta.
Sequence
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDA
REDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS
Sequence length 211
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  SNARE interactions in vesicular transport
Platelet activation
  ER-Phagosome pathway
trans-Golgi Network Vesicle Budding
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma LHGDN 18457912
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 30943982, 34088337 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 27855700
★☆☆☆☆
Found in Text Mining only
cervical cancer Cervical Cancer BEFREE 29908998
★☆☆☆☆
Found in Text Mining only
Cervix carcinoma Cervix carcinoma BEFREE 29908998
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 37086961 Associate
★☆☆☆☆
Found in Text Mining only
Cystic Fibrosis Cystic Fibrosis BEFREE 22892532
★☆☆☆☆
Found in Text Mining only
Cystic Fibrosis Cystic fibrosis Pubtator 22892532 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 20460426 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 19754436, 20460426, 25123125, 30102258
★☆☆☆☆
Found in Text Mining only