RIPK2 (receptor interacting serine/threonine kinase 2)

Gene

• Entrez ID: 8767
• Gene name: Receptor interacting serine/threonine kinase 2
• Gene symbol: RIPK2
• Synonyms (NCBI Gene): CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
• Chromosome: 8
• Chromosome location: 8q21.3
• Summary: This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024084	hsa-miR-1-3p	Microarray	18668037
MIRT027839	hsa-miR-98-5p	Microarray	19088304
MIRT1307617	hsa-miR-1290	CLIP-seq
MIRT1307618	hsa-miR-200b	CLIP-seq
MIRT1307619	hsa-miR-200c	CLIP-seq
MIRT1307620	hsa-miR-3133	CLIP-seq
MIRT1307621	hsa-miR-320a	CLIP-seq
MIRT1307622	hsa-miR-320b	CLIP-seq
MIRT1307623	hsa-miR-320c	CLIP-seq
MIRT1307624	hsa-miR-320d	CLIP-seq
MIRT1307625	hsa-miR-3545-3p	CLIP-seq
MIRT1307626	hsa-miR-3668	CLIP-seq
MIRT1307627	hsa-miR-3680	CLIP-seq
MIRT1307628	hsa-miR-374c	CLIP-seq
MIRT1307629	hsa-miR-429	CLIP-seq
MIRT1307630	hsa-miR-4429	CLIP-seq
MIRT1307631	hsa-miR-4699-3p	CLIP-seq
MIRT1307632	hsa-miR-4798-3p	CLIP-seq
MIRT1307633	hsa-miR-548b-3p	CLIP-seq
MIRT1307634	hsa-miR-548p	CLIP-seq
MIRT1307635	hsa-miR-655	CLIP-seq
MIRT1553111	hsa-miR-495	CLIP-seq
MIRT1553112	hsa-miR-802	CLIP-seq
MIRT2091169	hsa-miR-487a	CLIP-seq
MIRT2315924	hsa-miR-3185	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	19693652
RELA	Activation	19693652

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9642260
GO:0004706	Function	JUN kinase kinase kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	24790089
GO:0005515	Function	Protein binding	IPI	11432859, 11536016, 15383541, 16418290, 17054981, 19337385, 19667203, 21887730, 21903422, 21931591, 21931826, 22829933, 23333941, 23818254, 25416956, 27812135, 28436939, 29997244, 31515488, 32707033, 35273242, 36931259, 37398436, 38012669, 38191507
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21887730
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	21887730
GO:0005886	Component	Plasma membrane	IDA	17355968
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IDA	16920334
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9642260
GO:0006954	Process	Inflammatory response	TAS	9705938
GO:0007165	Process	Signal transduction	TAS	9642260
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 34721373
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	ISS
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0030274	Function	LIM domain binding	IPI	15657077
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	15620648
GO:0031398	Process	Positive regulation of protein ubiquitination	NAS	22412986
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031982	Component	Vesicle	IDA	21887730
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	NAS	22412986
GO:0032728	Process	Positive regulation of interferon-beta production	NAS	22412986
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	11432859
GO:0032735	Process	Positive regulation of interleukin-12 production	NAS	22412986
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0032991	Component	Protein-containing complex	IDA	11536016, 15383541, 21887730
GO:0032991	Component	Protein-containing complex	IMP	11432859
GO:0033080	Process	Immature T cell proliferation in thymus	IEA
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IEA
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IDA	11894098
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0035591	Function	Signaling adaptor activity	IDA	16824733, 29452636, 30026309, 30279485, 30478312
GO:0035739	Process	CD4-positive, alpha-beta T cell proliferation	IEA
GO:0038066	Process	P38MAPK cascade	IDA	10330143, 11460167
GO:0042098	Process	T cell proliferation	IEA
GO:0042742	Process	Defense response to bacterium	IDA	11460167, 18079694, 19136968, 22607974
GO:0042742	Process	Defense response to bacterium	IDA	16824733, 29452636
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	19337385
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	9346484, 10329646, 11460167, 18079694, 23806334, 27777308
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	25038658
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	23806334
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	22412986
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0050700	Function	CARD domain binding	IDA	10329646
GO:0050700	Function	CARD domain binding	IPI	11087742
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	21887730
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051260	Process	Protein homooligomerization	IDA	30279485, 30478312
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IBA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IDA	29452636, 30279485
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070431	Process	Nucleotide-binding oligomerization domain containing 2 signaling pathway	IDA	16824733, 17355968, 17562858, 23806334, 28545134, 29452636, 30026309, 30279485, 30478312
GO:0070431	Process	Nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070555	Process	Response to interleukin-1	IEA
GO:0070671	Process	Response to interleukin-12	IEA
GO:0070673	Process	Response to interleukin-18	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071224	Process	Cellular response to peptidoglycan	IEA
GO:0071225	Process	Cellular response to muramyl dipeptide	IDA	21887730
GO:0071225	Process	Cellular response to muramyl dipeptide	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0089720	Function	Caspase binding	IPI	11432859, 11536016, 15383541
GO:0097039	Process	Protein linear polyubiquitination	IDA	23806334
GO:0098792	Process	Xenophagy	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140895	Process	Cell surface toll-like receptor signaling pathway	IEA
GO:1902523	Process	Positive regulation of protein K63-linked ubiquitination	IDA	17562858
GO:1904417	Process	Positive regulation of xenophagy	IEA
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IEA

Other IDs

• MIM: 603455
• HGNC: 10020
• e!Ensembl: ENSG00000104312

Protein

• UniProt ID: O43353
• Protein name: Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (CARD-containing interleukin-1 beta-converting enzyme-associated kinase) (CARD-containing IL-1 beta ICE-kinase) (RIP-like-interacting CLARP kinase) (Receptor-interacting protein 2) (RIP-
• Protein function: Serine/threonine/tyrosine-protein kinase that plays an essential role in modulation of innate and adaptive immune responses (PubMed:14638696, PubMed:17054981, PubMed:21123652, PubMed:28656966, PubMed:9575181, PubMed:9642260). Acts as a key effec
• PDB: 2N7Z, 2N83, 4C8B, 5AR2, 5AR3, 5AR4, 5AR5, 5AR7, 5AR8, 5J79, 5J7B, 5NG0, 5NG2, 5NG3, 5W5J, 5W5O, 5YRN, 6ES0, 6FU5, 6GFJ, 6GGS, 6HMX, 6RN8, 6RNA, 6S1F, 6SZE, 6SZJ, 6UL8, 7OBS, 7OBT, 8AZA, 8X2O, 9F3V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07714	PK_Tyr_Ser-Thr	18 → 290	Protein tyrosine and serine/threonine kinase	Domain
  PF00619	CARD	437 → 523	Caspase recruitment domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in heart, brain, placenta, lung, peripheral blood leukocytes, spleen, kidney, testis, prostate, pancreas and lymph node. {ECO:0000269|PubMed:9575181, ECO:0000269|PubMed:9642260}.
• Sequence:

  MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
  KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
  RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
  SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
  SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
  TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
  SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
  PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
  PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
  

• Sequence length: 540

Pathways

KEGG:

NOD-like receptor signaling pathway
Neurotrophin signaling pathway
Shigellosis
Salmonella infection
Tuberculosis

Reactome:

NOD1/2 Signaling Pathway
Downstream TCR signaling
p75NTR recruits signalling complexes
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
Ovarian tumor domain proteases
Interleukin-1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy, susceptibility to, 1	Uncertain risk allele	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28885268, 31465316		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28963856, 29360461, 29717784, 31044631, 31248019		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10457335, 10749330, 1688394, 17584144, 28369403		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31571874		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15177938		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22749944, 28376371, 28617551		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20118543, 2226098		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12189558, 19697327		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28458565		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28885268, 31465316		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	22593272		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36635346	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30092165		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29043413, 30683474, 30814496		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	CTD_human_DG	22903826, 24385417		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	26979077, 28701913, 28964791, 29433086, 30508896, 30618146		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	10235270, 11244486, 12627462, 20542521, 21978736, 22553078, 26454231, 30281531, 30342011, 31526831, 31807925		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	26454231	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10235270, 11244486, 12627462, 20542521, 21978736, 22553078, 26454231, 30281531, 30342011, 31526831, 31807925		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21959219, 27939575		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29463017, 29659823		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17075290, 23794710		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17075290		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27306028, 29693188, 7988054		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21959219, 27939575		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21236705, 30344914		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	BEFREE	31749904		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27352187, 28586041, 29454324		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	28166214, 29907633	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36071494	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	15682471, 23701593		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasm	Biliary Tract Neoplasm	LHGDN	15682471		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	15682471, 23701593	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21978736, 26596365, 9491815		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28258492, 28819432		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	36567775	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	7988054		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23399321, 24642040, 26472474, 26712154, 26820121, 29258115, 29421659, 29497310, 29636857, 29685157, 29750309, 29956731, 30514345, 30655703, 30867707, 31486496, 31496747, 31513385, 31571870		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25186909, 26395295, 26472474, 27251275	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24817964, 9239407	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12851875, 15040018, 19627395		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28258492, 28819432		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28337291, 28966280, 29324317, 29771418, 30569167, 31004634, 31164163, 31378128		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33204717	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33790054	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29716743, 30395153, 31062766		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21959219, 27939575		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922	Associate	★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	2862602, 4040614		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12149109, 28186337		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29258757		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27176229, 29721044, 30336948, 31212131, 31266812, 31779593, 31819492		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27176229, 29721044, 30336948, 31212131, 31266812, 31779593, 31819492		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28885268, 31465316		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28422725, 28592124		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	15908333, 27472474, 28186337, 7557108, 9186837		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	15908333, 17944886, 27472474, 28186337, 7557108, 9186837		★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	26228366, 28186337, 28592602, 28625150		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31839711		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30394320		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	22828789		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22828789	Associate	★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23892723		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11830556, 26655741, 29364475, 30468467, 30484020, 31432387, 31686843		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26508021	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10913157, 14667936, 14764072, 17936921, 25282590, 27906435, 28427191, 28817833, 29364478, 29593420, 29661228, 30106441, 30144184, 30588113, 30858757, 30892955, 31002365, 31139021, 31281542, 31350343, 31380280, 31640089, 31728833, 7593130		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32535071, 34356990	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31697943		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28895407, 28915618, 28938565, 30856284		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25627687, 29130944, 30799377		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27655020, 28098906, 28656260, 28708205, 28849086, 29019371, 29556316, 31534544		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15620648	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19266573, 21887730, 25213858		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29356574, 29659823		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	25778803		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29803785		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	1631063	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23315994, 28592602, 29329158, 30449207		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15908333, 17584142, 23315994, 28506430, 28592602, 29329158, 30449207		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28592602	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31691451	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24462878, 30449207		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11773861, 17584142, 24018334, 28938439, 29412823, 31691451		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31485193		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	26327765	Inhibit	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25344211, 28461758, 30755239		★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	2320253		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28724546		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28640224, 29256357, 29888640, 30070313, 30925454, 31298316, 31486482, 31545414		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	27885812		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	26508021	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	30171525	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	2060503		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30395153, 31062766		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	31419570		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25815591, 26159783, 26202395, 29290767, 29771414, 30569171		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25815591, 26159783, 29290767, 29771414, 30569171		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	15328192, 1631063, 17438102, 27875906		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	29780828		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	29780828		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31297627		★☆☆☆☆ Found in Text Mining only
Feeding Disorders	Feeding Disorders	BEFREE	7937354		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29780828		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	15743365		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	CTD_human_DG	7481522		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	17944886, 25090123, 27084680, 28378944, 31516389		★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	26228366	Associate	★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	10422768, 10458643, 11025360, 11787760, 15024038, 9872509		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	22300015		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	CTD_human_DG	7481522		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19627395, 26589942, 29740484		★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	27995402		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28476784, 28618251, 28849154, 29693188, 29768063, 30186853, 30657566, 31295040, 31456594, 31799672		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28476784, 28618251, 28849154, 29531296, 29693188, 29768063, 30186853, 30657566, 30846550, 31115583, 31295040, 31456594, 31799672		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12469207, 18423848, 22234798, 24357514, 27733185, 29693188, 30228024, 30542720, 30924320, 30992674, 31138033, 31167206, 31319814, 31654739, 31831299		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18423848		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33069830, 37914353	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	12469207, 12657185		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	10668930, 10803770, 12777967, 15313848, 27084212		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29130944		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25627687, 29130944, 30799377		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31646606		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	31037734		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16354923		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	16354923		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	24692543, 28592602		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31485193		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25213858, 29093615, 29555876, 30108786		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36983040	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	29874851, 30405083		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	19627395		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	9296339		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28186337		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	23281400		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30664713		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	19034965		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	26327765, 34055657	Associate	★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	27306028		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	31070711		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33790054	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	9920090		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	GWASDB_DG	20018961, 22019778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	GWASCAT_DG	20018961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	Pubtator	20018961, 24015287	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26261618, 28672980		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	24817964		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	25136578		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26055238, 26781180, 27074923, 27340352, 28112375, 28292020, 28333142, 28919047, 29187885, 29295728, 29316827, 29768256, 29898761, 30238408, 30293685, 30317540, 30536310, 30621754, 30663574, 30668319, 30774272, 31142342, 31297627, 31318685, 31551242, 31599410, 31656043, 31692433, 31754404, 31773699		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30508896		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30663574		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19627395		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22075569		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	25070240		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	30939042		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23399321, 24642040, 26472474, 26712154, 26820121, 29258115, 29421659, 29497310, 29636857, 29685157, 29750309, 29956731, 30514345, 30655703, 30867707, 31486496, 31496747, 31513385, 31571870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28640224, 29256357, 30070313, 31298316, 31486482, 31545414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25815591, 26159783, 29290767, 29771414, 30569171		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	17944886, 25090123, 27084680, 28378944, 31516389		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17584144		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28122304, 31105827, 31446646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20198494, 28337291, 28966280, 29324317, 29771418, 30569167, 31004634, 31164163, 31378128, 3193797		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29716743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10457335, 11444473, 12429993, 14749036, 15502642, 21186400, 21839751, 2226098, 24177032, 25469546, 27072272, 29043413, 29304760, 29360461, 29927319, 31303762, 8386784, 9041258		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23428540, 26700819, 28760843, 29123392, 29312807, 29658595, 30282072, 31155575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23201402, 25673265, 26537802, 27072272, 28114950, 28369403, 28431583, 29467894, 29762831, 30029874, 30636883, 31122696, 31364115, 31558304, 31599413, 31773680, 8844981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28258492, 28819432		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10457335, 10913157, 12429993, 12851875, 14749036, 15040018, 15328192, 15682471, 16909104, 17438102, 17584144, 22504414, 24177032, 24642040, 28369403, 28573788, 29105798, 29486482, 29487004, 29614418, 29672153, 29693188, 29888640, 29927319, 30108868, 30468472, 30878308, 31362565, 31541684		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27176229, 29721044, 30336948, 31212131, 31266812, 31779593, 31819492		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25673265, 26655741, 29364475, 30468467, 30484020, 31432387, 31686843		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28443064, 29692779		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29421659, 29637742		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	23399917		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	PSYGENET_DG	23399917		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10452322, 29663167		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29543785, 29808164		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38069171	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15980969, 26840621		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29803785		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	21978736, 26608796, 28343167		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28484277		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26052894	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26052894		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32276265	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30739077		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	12116188		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32041789	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30292410		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15755681		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31138265		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29130944		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27498905, 29991129, 30416986, 31813603		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10452322, 12429993, 15328192, 15502642, 1631063, 16909104, 17584144, 17934729, 19627395, 20198494, 21186400, 22993319, 24642040, 26063204, 27035228, 27306028, 27323123, 2753982, 27733185, 27777493, 27875420, 28337291, 28382147, 2842785, 28895407, 29043413, 29131264, 29175326, 29387243, 29406549, 29693188, 29766185, 29927319, 30261494, 30338799, 30579733, 30630006, 30643816, 30662328, 30774377, 30945457, 31002132, 31102887, 31169265, 31243669, 31301414, 31387622, 31428569, 31442551, 31481019, 31549214, 3472248, 7593130, 7988054, 9296339, 9679761, 9920090		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1360635, 1720402, 17438102, 8453059		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1720402	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	1320892, 1631063, 1977617, 2384178, 2753982, 7694875, 8413849		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27306028, 27875420, 28450850, 9920090		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	31813603		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11429190, 24471765, 25686496, 26063204, 26852748, 27097942, 27473273, 28428733, 28501870, 28993193, 29228425, 29364481, 29393465, 29484330, 29510387, 29537214, 29738778, 29864936, 30575912, 30638403, 30911072, 31615563, 31692261, 31749621, 31799663, 31811854, 31815619		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31297627		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	27084212, 28716235		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	11074497, 26381270, 28592602, 34371941	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11773861, 16362631, 17584142, 19295535, 23315994, 25984632, 26381270, 28592602, 28724546, 29412823, 30069617, 30537704, 30591538, 30624060, 30843875, 31539554, 7489984, 7557108		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	29360396		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30146742		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26202364, 28082035, 28762960, 28882648, 28924379, 29048685, 29573114, 29853100, 30092789, 30405785, 30468462, 31210288, 31421084, 31464976		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29716743		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35477477	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10457335, 11444473, 11830556, 12429993, 14749036, 15502642, 21186400, 21839751, 2226098, 24177032, 25469546, 27072272, 29043413, 29304760, 29360461, 29927319, 31303762, 8386784, 9041258		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	12851875		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25469546, 8925905	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	CTD_human_DG	16187300, 16499907		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	18336667, 24177032, 28506430, 29284677, 29555876, 31171354, 31598921, 9832635		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	19535979, 28385584, 31598921		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	11244486, 11803530, 15346539, 21978736, 22939006, 26454231, 31374578, 8104032, 8837709		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	10395221, 11244486, 11344357, 11443535, 11803530, 12116188, 12627462, 12627463, 15108185, 15354400, 15722953, 18832011, 20023595, 22414867, 22553078, 22939006, 26454231, 7937354, 8104032, 8837709, 9603610, 9754694		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	11713976		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	26454231	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29901070, 30531691		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10668930, 12777967, 15313848, 27084212, 28716235		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	12777967, 15313848		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36593912	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29237928		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	15624269		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21827375	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21827375	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	26454231		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29541198		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30370525		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23428540, 26700819, 28760843, 29123392, 29312807, 29658595, 30282072, 31155575		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34777331	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30902899		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27084212, 28716235		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27655020, 28098906, 28656260, 28708205, 28849086, 29019371, 29556316, 31534544		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	26191215		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	1631063, 17438102		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	1631063	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26782542, 28987940, 31234900		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	27402699	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29463017		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15328192		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	1631063	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	27875906		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11443535, 11549403, 11803530, 12116180, 17471287, 18606950, 20732371, 26596365, 28214898, 7640324, 9278188, 9491815		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	11549403, 17471287		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28521244, 30998649		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	27039262	Associate	★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30902899		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11429190, 1977617, 30008888, 8221657		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24817964		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28345457, 29218108, 30257352, 30518397, 30867685, 31297133, 31754291		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24817964, 27557518, 36353608	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27966775		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29901115, 31413738		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29385406, 30132559		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31297627		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23201402, 26537802, 27072272, 28114950, 28369403, 28431583, 29467894, 29762831, 30029874, 30636883, 31122696, 31364115, 31558304, 31599413, 31773680		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1511743, 27072272	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28009988, 29516967		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17584144, 20198494		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24642040, 28570501, 29126392, 29215701, 29310680, 29421659, 31186039, 31298383		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24642040, 33297339	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	26356487		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20452301, 31610014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	20452301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	31002139		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	30205395		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	6265841		★☆☆☆☆ Found in Text Mining only