Gene Gene information from NCBI Gene database.
Entrez ID 8764
Gene name TNF receptor superfamily member 14
Gene symbol TNFRSF14
Synonyms (NCBI Gene)
ATARCD270HVEAHVEMLIGHTRTR2
Chromosome 1
Chromosome location 1p36.32
Summary This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral e
miRNA miRNA information provided by mirtarbase database.
22
miRTarBase ID miRNA Experiments Reference
MIRT1442976 hsa-miR-3138 CLIP-seq
MIRT1442977 hsa-miR-4520a-3p CLIP-seq
MIRT1442978 hsa-miR-718 CLIP-seq
MIRT1442979 hsa-miR-876-3p CLIP-seq
MIRT2132563 hsa-miR-188-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002720 Process Positive regulation of cytokine production involved in immune response IBA
GO:0005031 Function Tumor necrosis factor receptor activity TAS 9153189
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602746 11912 ENSG00000157873
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92956
Protein name Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
Protein function Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling ne
PDB 1JMA , 2AW2 , 4FHQ , 4RSU , 5T2Q , 5T2R , 6NG3 , 7MSG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 78 119 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with the highest expression in lung, spleen and thymus. Expressed in a subpopulation of B cells and monocytes (PubMed:18193050). Expressed in naive T cells (PubMed:19915044). {ECO:0000269|PubMed:18193050, ECO:0000269|
Sequence
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Sequence length 283
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Virion - Herpesvirus
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Herpes simplex virus 1 infection
  Costimulation by the CD28 family
TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ankylosing spondylitis Ankylosing Spondylitis GWASCAT_DG 26974007
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Anodontia Anodontia Pubtator 36675305 Associate
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 19234211, 28004300
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 15667572, 17393389, 19644859, 20187130, 23460240, 27898717, 28925718 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma LHGDN 14749527
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma Pubtator 24782592, 40234829 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma BEFREE 29616048
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Atherosclerosis Atherosclerosis LHGDN 11742858
★☆☆☆☆
Found in Text Mining only
Autoimmune Chronic Hepatitis Autoimmune hepatitis BEFREE 15696194
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 15696194, 15944326, 19234211, 28404853, 31562209, 31758531
★☆☆☆☆
Found in Text Mining only