Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8761
Gene name	Poly(A) binding protein cytoplasmic 4
Gene symbol	PABPC4
Synonyms (NCBI Gene)	APP-1APP1PABP4iPABP
Chromosome	1
Chromosome location	1p34.3
Summary	Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 m

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022926	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024565	hsa-miR-215-5p	Microarray	19074876
MIRT026691	hsa-miR-192-5p	Microarray	19074876
MIRT027746	hsa-miR-98-5p	Microarray	19088304
MIRT031882	hsa-miR-16-5p	Proteomics	18668040
MIRT031882	hsa-miR-16-5p	CLASH	23622248
MIRT046051	hsa-miR-125b-5p	CLASH	23622248
MIRT044975	hsa-miR-186-5p	CLASH	23622248
MIRT039627	hsa-miR-615-3p	CLASH	23622248
MIRT440057	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440057	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1209546	hsa-miR-1197	CLIP-seq
MIRT1209547	hsa-miR-1231	CLIP-seq
MIRT1209548	hsa-miR-1264	CLIP-seq
MIRT1209549	hsa-miR-1275	CLIP-seq
MIRT1209550	hsa-miR-1285	CLIP-seq
MIRT1209551	hsa-miR-1323	CLIP-seq
MIRT1209552	hsa-miR-141	CLIP-seq
MIRT1209553	hsa-miR-200a	CLIP-seq
MIRT1209554	hsa-miR-2054	CLIP-seq
MIRT1209555	hsa-miR-219-1-3p	CLIP-seq
MIRT1209556	hsa-miR-3119	CLIP-seq
MIRT1209557	hsa-miR-3120-5p	CLIP-seq
MIRT1209558	hsa-miR-3133	CLIP-seq
MIRT1209559	hsa-miR-3140-3p	CLIP-seq
MIRT1209560	hsa-miR-3148	CLIP-seq
MIRT1209561	hsa-miR-3187-5p	CLIP-seq
MIRT1209562	hsa-miR-3189-3p	CLIP-seq
MIRT1209563	hsa-miR-362-5p	CLIP-seq
MIRT1209564	hsa-miR-378g	CLIP-seq
MIRT1209565	hsa-miR-3936	CLIP-seq
MIRT1209566	hsa-miR-3977	CLIP-seq
MIRT1209567	hsa-miR-4314	CLIP-seq
MIRT1209568	hsa-miR-4452	CLIP-seq
MIRT1209569	hsa-miR-4476	CLIP-seq
MIRT1209570	hsa-miR-4486	CLIP-seq
MIRT1209571	hsa-miR-450b-5p	CLIP-seq
MIRT1209572	hsa-miR-4525	CLIP-seq
MIRT1209573	hsa-miR-4640-5p	CLIP-seq
MIRT1209574	hsa-miR-4665-5p	CLIP-seq
MIRT1209575	hsa-miR-4667-5p	CLIP-seq
MIRT1209576	hsa-miR-4668-5p	CLIP-seq
MIRT1209577	hsa-miR-4694-5p	CLIP-seq
MIRT1209578	hsa-miR-4700-5p	CLIP-seq
MIRT1209579	hsa-miR-4723-5p	CLIP-seq
MIRT1209580	hsa-miR-4726-5p	CLIP-seq
MIRT1209581	hsa-miR-500a	CLIP-seq
MIRT1209582	hsa-miR-500b	CLIP-seq
MIRT1209583	hsa-miR-513a-3p	CLIP-seq
MIRT1209584	hsa-miR-548c-3p	CLIP-seq
MIRT1209585	hsa-miR-548o	CLIP-seq
MIRT1209586	hsa-miR-571	CLIP-seq
MIRT1209587	hsa-miR-587	CLIP-seq
MIRT1209588	hsa-miR-612	CLIP-seq
MIRT1209589	hsa-miR-625	CLIP-seq
MIRT1209590	hsa-miR-637	CLIP-seq
MIRT1209591	hsa-miR-922	CLIP-seq
MIRT1209556	hsa-miR-3119	CLIP-seq
MIRT1209559	hsa-miR-3140-3p	CLIP-seq
MIRT1209565	hsa-miR-3936	CLIP-seq
MIRT1209587	hsa-miR-587	CLIP-seq
MIRT1209546	hsa-miR-1197	CLIP-seq
MIRT2288519	hsa-miR-1225-5p	CLIP-seq
MIRT1209548	hsa-miR-1264	CLIP-seq
MIRT2288520	hsa-miR-192	CLIP-seq
MIRT1209554	hsa-miR-2054	CLIP-seq
MIRT2288521	hsa-miR-215	CLIP-seq
MIRT1209555	hsa-miR-219-1-3p	CLIP-seq
MIRT1209556	hsa-miR-3119	CLIP-seq
MIRT1209559	hsa-miR-3140-3p	CLIP-seq
MIRT1209562	hsa-miR-3189-3p	CLIP-seq
MIRT1209563	hsa-miR-362-5p	CLIP-seq
MIRT1209565	hsa-miR-3936	CLIP-seq
MIRT1209566	hsa-miR-3977	CLIP-seq
MIRT2288522	hsa-miR-4432	CLIP-seq
MIRT1209568	hsa-miR-4452	CLIP-seq
MIRT1209569	hsa-miR-4476	CLIP-seq
MIRT1209577	hsa-miR-4694-5p	CLIP-seq
MIRT2288523	hsa-miR-499-3p	CLIP-seq
MIRT2288524	hsa-miR-499-5p	CLIP-seq
MIRT2288525	hsa-miR-499a-3p	CLIP-seq
MIRT1209581	hsa-miR-500a	CLIP-seq
MIRT1209582	hsa-miR-500b	CLIP-seq
MIRT1209583	hsa-miR-513a-3p	CLIP-seq
MIRT1209586	hsa-miR-571	CLIP-seq
MIRT1209587	hsa-miR-587	CLIP-seq
MIRT1209546	hsa-miR-1197	CLIP-seq
MIRT1209548	hsa-miR-1264	CLIP-seq
MIRT2288520	hsa-miR-192	CLIP-seq
MIRT1209554	hsa-miR-2054	CLIP-seq
MIRT2288521	hsa-miR-215	CLIP-seq
MIRT1209555	hsa-miR-219-1-3p	CLIP-seq
MIRT1209562	hsa-miR-3189-3p	CLIP-seq
MIRT1209563	hsa-miR-362-5p	CLIP-seq
MIRT2586590	hsa-miR-3662	CLIP-seq
MIRT1209565	hsa-miR-3936	CLIP-seq
MIRT1209568	hsa-miR-4452	CLIP-seq
MIRT1209569	hsa-miR-4476	CLIP-seq
MIRT1209571	hsa-miR-450b-5p	CLIP-seq
MIRT1209577	hsa-miR-4694-5p	CLIP-seq
MIRT2586591	hsa-miR-4698	CLIP-seq
MIRT1209581	hsa-miR-500a	CLIP-seq
MIRT1209582	hsa-miR-500b	CLIP-seq
MIRT1209583	hsa-miR-513a-3p	CLIP-seq
MIRT1209586	hsa-miR-571	CLIP-seq
MIRT1209587	hsa-miR-587	CLIP-seq
MIRT1209546	hsa-miR-1197	CLIP-seq
MIRT1209548	hsa-miR-1264	CLIP-seq
MIRT2288520	hsa-miR-192	CLIP-seq
MIRT1209554	hsa-miR-2054	CLIP-seq
MIRT2288521	hsa-miR-215	CLIP-seq
MIRT1209555	hsa-miR-219-1-3p	CLIP-seq
MIRT1209562	hsa-miR-3189-3p	CLIP-seq
MIRT1209563	hsa-miR-362-5p	CLIP-seq
MIRT2586590	hsa-miR-3662	CLIP-seq
MIRT1209569	hsa-miR-4476	CLIP-seq
MIRT1209571	hsa-miR-450b-5p	CLIP-seq
MIRT1209577	hsa-miR-4694-5p	CLIP-seq
MIRT2586591	hsa-miR-4698	CLIP-seq
MIRT1209581	hsa-miR-500a	CLIP-seq
MIRT1209582	hsa-miR-500b	CLIP-seq
MIRT1209583	hsa-miR-513a-3p	CLIP-seq
MIRT1209586	hsa-miR-571	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0005515	Function	Protein binding	IPI	11369516, 27871484
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21940797
GO:0005737	Component	Cytoplasm	IDA	8524242, 21940797
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8524242
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006396	Process	RNA processing	TAS	8524242
GO:0006401	Process	RNA catabolic process	TAS	8524242
GO:0006412	Process	Translation	TAS	8524242
GO:0007596	Process	Blood coagulation	TAS	9030741
GO:0008143	Function	Poly(A) binding	IBA
GO:0008143	Function	Poly(A) binding	IDA	8524242
GO:0008143	Function	Poly(A) binding	IEA
GO:0008143	Function	Poly(A) binding	TAS	9030741
GO:0008266	Function	Poly(U) RNA binding	IBA
GO:0008266	Function	Poly(U) RNA binding	IDA	8524242
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:0010494	Component	Cytoplasmic stress granule	IDA	21940797
GO:0017130	Function	Poly(C) RNA binding	IDA	8524242
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0061515	Process	Myeloid cell development	IEA
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661

MIM	HGNC	e!Ensembl
603407	8557	ENSG00000090621

Q13310

Protein name

Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP)

Protein function

Binds the poly(A) tail of mRNA (PubMed:8524242). Binds to SMIM26 mRNA and plays a role in its post-transcriptional regulation (PubMed:37009826). May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytopla

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	13 → 83	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	101 → 168	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	193 → 261	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	296 → 364	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00658	PABP	556 → 623	Poly-adenylate binding protein, unique domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at low levels in resting normal T cells; following T-cell activation, however, mRNA levels are rapidly up-regulated.

Sequence

MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEK
HEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGS
KPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDF
GGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQ
APQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNS
ELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS

Sequence length

644

Interactions

View interactions

	KEGG
	mRNA surveillance pathway RNA degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	33730015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23181716, 37511575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37324188, 37603831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22884093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37540242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	27189021, 29358691, 30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666673, 15255950, 16432153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30530815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28435529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11238715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16714280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	16432153		★★★★★ ★☆☆☆☆ Found in Text Mining only

PABPC4 (poly(A) binding protein cytoplasmic 4)