ADAM15 (ADAM metallopeptidase domain 15)

Gene

• Entrez ID: 8751
• Gene name: ADAM metallopeptidase domain 15
• Gene symbol: ADAM15
• Synonyms (NCBI Gene): MDC15
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytoki

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022149	hsa-miR-124-3p	Microarray	18668037
MIRT050739	hsa-miR-18a-5p	CLASH	23622248
MIRT053385	hsa-miR-363-3p	qRT-PCR	23806264
MIRT735210	hsa-miR-3174	qRT-PCR	32547057
MIRT765942	hsa-miR-1273e	CLIP-seq
MIRT765943	hsa-miR-2277-3p	CLIP-seq
MIRT765944	hsa-miR-3659	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765946	hsa-miR-1247	CLIP-seq
MIRT765942	hsa-miR-1273e	CLIP-seq
MIRT765947	hsa-miR-137	CLIP-seq
MIRT765948	hsa-miR-147b	CLIP-seq
MIRT765943	hsa-miR-2277-3p	CLIP-seq
MIRT765949	hsa-miR-25	CLIP-seq
MIRT765950	hsa-miR-32	CLIP-seq
MIRT765951	hsa-miR-326	CLIP-seq
MIRT765952	hsa-miR-330-5p	CLIP-seq
MIRT765953	hsa-miR-363	CLIP-seq
MIRT765944	hsa-miR-3659	CLIP-seq
MIRT765954	hsa-miR-3667-3p	CLIP-seq
MIRT765955	hsa-miR-367	CLIP-seq
MIRT765956	hsa-miR-4438	CLIP-seq
MIRT765957	hsa-miR-4468	CLIP-seq
MIRT765958	hsa-miR-4652-5p	CLIP-seq
MIRT765959	hsa-miR-4704-3p	CLIP-seq
MIRT765960	hsa-miR-4754	CLIP-seq
MIRT765961	hsa-miR-508-5p	CLIP-seq
MIRT765962	hsa-miR-520a-5p	CLIP-seq
MIRT765963	hsa-miR-525-5p	CLIP-seq
MIRT765964	hsa-miR-566	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765965	hsa-miR-891b	CLIP-seq
MIRT765966	hsa-miR-92a	CLIP-seq
MIRT765967	hsa-miR-92b	CLIP-seq
MIRT765947	hsa-miR-137	CLIP-seq
MIRT765949	hsa-miR-25	CLIP-seq
MIRT765950	hsa-miR-32	CLIP-seq
MIRT765951	hsa-miR-326	CLIP-seq
MIRT765952	hsa-miR-330-5p	CLIP-seq
MIRT765953	hsa-miR-363	CLIP-seq
MIRT765955	hsa-miR-367	CLIP-seq
MIRT765956	hsa-miR-4438	CLIP-seq
MIRT765957	hsa-miR-4468	CLIP-seq
MIRT1925697	hsa-miR-593	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765965	hsa-miR-891b	CLIP-seq
MIRT765966	hsa-miR-92a	CLIP-seq
MIRT765967	hsa-miR-92b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IMP	22505472
GO:0002418	Process	Immune response to tumor cell	IDA	22505472
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IMP	22505472
GO:0005515	Function	Protein binding	IPI	10531379, 11741929, 15280379, 16374509, 25416956, 25825872, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0005929	Component	Cilium	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IDA	22505472
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	TAS	9516430
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	22505472
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	12777399
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9516430
GO:0008584	Process	Male gonad development	IEA
GO:0009986	Component	Cell surface	IDA	22505472
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0017124	Function	SH3 domain binding	IPI	10531379
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030308	Process	Negative regulation of cell growth	IMP	22505472
GO:0030336	Process	Negative regulation of cell migration	IMP	22505472
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IPI	12777399
GO:0042246	Process	Tissue regeneration	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	22505472
GO:0046872	Function	Metal ion binding	IEA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0070062	Component	Extracellular exosome	IDA	22505472
GO:0070161	Component	Anchoring junction	IEA
GO:1900121	Process	Negative regulation of receptor binding	IMP	22505472
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IDA	22505472
GO:1990910	Process	Response to hypobaric hypoxia	IEA

Other IDs

• MIM: 605548
• HGNC: 193
• e!Ensembl: ENSG00000143537

Protein

• UniProt ID: Q13444
• Protein name: Disintegrin and metalloproteinase domain-containing protein 15 (ADAM 15) (EC 3.4.24.-) (Metalloprotease RGD disintegrin protein) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metargidin)
• Protein function: Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-med
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01562	Pep_M12B_propep	29 → 160	Reprolysin family propeptide	Family
  PF01421	Reprolysin	213 → 414	Reprolysin (M12B) family zinc metalloprotease	Domain
  PF00200	Disintegrin	430 → 503	Disintegrin	Domain
  PF08516	ADAM_CR	508 → 627	ADAM cysteine-rich	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothe
• Sequence:

  MRLALLWALGLLGAGSPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDDLPISLKKV
  LQTSLPEPLRIKLELDGDSHILELLQNRELVPGRPTLVWYQPDGTRVVSEGHTLENCCYQ
  GRVRGYAGSWVSICTCSGLRGLVVLTPERSYTLEQGPGDLQGPPIISRIQDLHLPGHTCA
  LSWRESVHTQKPPEHPLGQRHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTL
  EVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
  AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDL
  PGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPM
  AAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQC
  RPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQ
  PAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLW
  ETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSK
  CHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTTGLLLSLLVLLVLVMLGASYWYRAR
  LHQRLCQLKGPTCQYRAAQSGPSERPGPPQRALLARGTKQASALSFPAPPSRPLPPDPVS
  KRLQAELADRPNPPTRPLPADPVVRSPKSQGPAKPPPPRKPLPADPQGRCPSGDLPGPGA
  GIPPLVVPSRPAPPPPTVSSLYL

• Sequence length: 863

Pathways

Reactome:

Degradation of the extracellular matrix
Invadopodia formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15756594		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16756724		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	21190186		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23314034		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12858346, 20227692, 22904271		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11592366, 16277668, 23918525, 30634456	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12858346, 20227692, 22904271		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	11839628		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	LHGDN	11839628		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26930657		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	16949178		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15384173, 19487280, 24317528, 31467400		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15565459, 16756724, 18296648, 18434311, 24317528, 31467400	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15756594, 21190186		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34426560	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39346916	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26930657		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15756594, 26323669		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10513811, 11592366	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10513811		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10513811	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21190186		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11592366, 15818704, 16277668		★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	15337756		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	16894352		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16894352	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21190186		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15384173, 18296648, 19487280, 24317528, 31467400		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26323669		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17465204		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18281484, 19229865, 28282546		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26930657		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17465204, 17937806, 26323669, 30634456		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	15756594		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	18296648		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18296648		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10329602	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18695922		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20851104, 23649038		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21119930	Stimulate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18281484		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	39261477	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15618016, 15756594, 18281484, 18296648, 21190186, 22677901, 26930657, 28282546		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19308291	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26323669, 30584356		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11592366	Stimulate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15618016		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17465204		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23314034		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17465204	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36504281	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18281484, 19229865, 28282546		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18281484		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18281484		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28282546, 36613831	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32677970	Stimulate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11592366, 16277668, 23918525, 25650586, 30003689, 30634456		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29939250		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15756594		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25475780	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22677901	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26930657	Associate	★☆☆☆☆ Found in Text Mining only