Gene Gene information from NCBI Gene database.
Entrez ID 8744
Gene name TNF superfamily member 9
Gene symbol TNFSF9
Synonyms (NCBI Gene)
4-1BB-LCD137LTNLG5A
Chromosome 19
Chromosome location 19p13.3
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molec
miRNA miRNA information provided by mirtarbase database.
439
miRTarBase ID miRNA Experiments Reference
MIRT001405 hsa-miR-16-5p pSILAC 18668040
MIRT017011 hsa-miR-335-5p Microarray 18185580
MIRT027516 hsa-miR-98-5p Microarray 19088304
MIRT028983 hsa-miR-26b-5p Microarray 19088304
MIRT001405 hsa-miR-16-5p Proteomics;Other 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 8088337
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005515 Function Protein binding IPI 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606182 11939 ENSG00000125657
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P41273
Protein name Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL)
Protein function Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. {ECO:00002
PDB 2X29 , 6A3V , 6BWV , 6CPR , 6CU0 , 6D3N , 6FIB , 6MGE , 6MGP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 107 240 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, placenta, lung, skeletal muscle and kidney.
Sequence
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA
SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL
TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA
LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV

TPEIPAGLPSPRSE
Sequence length 254
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARDIOMYOPATHY, DILATED CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDITIS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 12594573, 18461674
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 31201235
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency BEFREE 31258752
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 18285570, 30778712
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 18285570, 30778712
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 24899613, 31631426 Associate
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 18285570, 31297111
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma BEFREE 19608748, 20463597
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 20127018, 26881506
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 26881506, 31182685 Associate
★☆☆☆☆
Found in Text Mining only