Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8740
Gene name	TNF superfamily member 14
Gene symbol	TNFSF14
Synonyms (NCBI Gene)	CD258HVEMLLIGHTLTg
Chromosome	19
Chromosome location	19p13.3
Summary	The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry media

220

Show/Hide all (220)

miRTarBase ID	miRNA	Experiments	Reference
MIRT685905	hsa-miR-4438	HITS-CLIP	23313552
MIRT685904	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT685903	hsa-miR-5095	HITS-CLIP	23313552
MIRT685902	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT650331	hsa-miR-4705	HITS-CLIP	23824327
MIRT561166	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561165	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT561163	hsa-miR-4775	PAR-CLIP	20371350
MIRT561164	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT561162	hsa-miR-3149	PAR-CLIP	20371350
MIRT561166	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561165	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT561163	hsa-miR-4775	PAR-CLIP	20371350
MIRT561164	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT561162	hsa-miR-3149	PAR-CLIP	20371350
MIRT532290	hsa-miR-2114-5p	PAR-CLIP	22012620
MIRT532289	hsa-miR-3691-3p	PAR-CLIP	22012620
MIRT532288	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT532287	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT532286	hsa-miR-4308	PAR-CLIP	22012620
MIRT532285	hsa-miR-4292	PAR-CLIP	22012620
MIRT532284	hsa-miR-6791-5p	PAR-CLIP	22012620
MIRT532283	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT532282	hsa-miR-4480	PAR-CLIP	22012620
MIRT532281	hsa-miR-6744-5p	PAR-CLIP	22012620
MIRT532280	hsa-miR-1255a	PAR-CLIP	22012620
MIRT532279	hsa-miR-1255b-5p	PAR-CLIP	22012620
MIRT532278	hsa-miR-3691-5p	PAR-CLIP	22012620
MIRT532277	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT532276	hsa-miR-1260a	PAR-CLIP	22012620
MIRT532275	hsa-miR-1260b	PAR-CLIP	22012620
MIRT532274	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT532273	hsa-miR-4433b-5p	PAR-CLIP	22012620
MIRT461943	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT461942	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT461941	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT461940	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT461939	hsa-miR-1307-3p	PAR-CLIP	23592263
MIRT461938	hsa-miR-4638-5p	PAR-CLIP	23592263
MIRT461937	hsa-miR-4695-3p	PAR-CLIP	23592263
MIRT461936	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT461935	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT461934	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT461933	hsa-miR-3650	PAR-CLIP	23592263
MIRT461932	hsa-miR-143-5p	PAR-CLIP	23592263
MIRT461931	hsa-miR-7977	PAR-CLIP	23592263
MIRT461930	hsa-miR-7641	PAR-CLIP	23592263
MIRT461929	hsa-miR-3198	PAR-CLIP	23592263
MIRT461928	hsa-miR-4309	PAR-CLIP	23592263
MIRT461927	hsa-miR-3689d	PAR-CLIP	23592263
MIRT461926	hsa-miR-5698	PAR-CLIP	23592263
MIRT685905	hsa-miR-4438	HITS-CLIP	23313552
MIRT685904	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT685903	hsa-miR-5095	HITS-CLIP	23313552
MIRT685902	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT650331	hsa-miR-4705	HITS-CLIP	23824327
MIRT561166	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561165	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT561163	hsa-miR-4775	PAR-CLIP	20371350
MIRT561164	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT561162	hsa-miR-3149	PAR-CLIP	20371350
MIRT561166	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT561165	hsa-miR-4735-5p	PAR-CLIP	20371350
MIRT561163	hsa-miR-4775	PAR-CLIP	20371350
MIRT561164	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT561162	hsa-miR-3149	PAR-CLIP	20371350
MIRT532290	hsa-miR-2114-5p	PAR-CLIP	22012620
MIRT532289	hsa-miR-3691-3p	PAR-CLIP	22012620
MIRT532288	hsa-miR-1224-3p	PAR-CLIP	22012620
MIRT532287	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT532286	hsa-miR-4308	PAR-CLIP	22012620
MIRT532285	hsa-miR-4292	PAR-CLIP	22012620
MIRT532284	hsa-miR-6791-5p	PAR-CLIP	22012620
MIRT532283	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT532282	hsa-miR-4480	PAR-CLIP	22012620
MIRT532281	hsa-miR-6744-5p	PAR-CLIP	22012620
MIRT532280	hsa-miR-1255a	PAR-CLIP	22012620
MIRT532279	hsa-miR-1255b-5p	PAR-CLIP	22012620
MIRT532278	hsa-miR-3691-5p	PAR-CLIP	22012620
MIRT532277	hsa-miR-188-3p	PAR-CLIP	22012620
MIRT532276	hsa-miR-1260a	PAR-CLIP	22012620
MIRT532275	hsa-miR-1260b	PAR-CLIP	22012620
MIRT532274	hsa-miR-3156-3p	PAR-CLIP	22012620
MIRT532273	hsa-miR-4433b-5p	PAR-CLIP	22012620
MIRT461943	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT461942	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT461941	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT461940	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT461939	hsa-miR-1307-3p	PAR-CLIP	23592263
MIRT461938	hsa-miR-4638-5p	PAR-CLIP	23592263
MIRT461937	hsa-miR-4695-3p	PAR-CLIP	23592263
MIRT461936	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT461935	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT461934	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT461933	hsa-miR-3650	PAR-CLIP	23592263
MIRT461932	hsa-miR-143-5p	PAR-CLIP	23592263
MIRT461931	hsa-miR-7977	PAR-CLIP	23592263
MIRT461930	hsa-miR-7641	PAR-CLIP	23592263
MIRT461929	hsa-miR-3198	PAR-CLIP	23592263
MIRT461928	hsa-miR-4309	PAR-CLIP	23592263
MIRT461927	hsa-miR-3689d	PAR-CLIP	23592263
MIRT461926	hsa-miR-5698	PAR-CLIP	23592263
MIRT1443384	hsa-miR-1200	CLIP-seq
MIRT1443385	hsa-miR-1207-3p	CLIP-seq
MIRT1443386	hsa-miR-2053	CLIP-seq
MIRT1443387	hsa-miR-3074-3p	CLIP-seq
MIRT1443388	hsa-miR-3140-5p	CLIP-seq
MIRT1443389	hsa-miR-3157-5p	CLIP-seq
MIRT1443390	hsa-miR-323b-5p	CLIP-seq
MIRT1443391	hsa-miR-34a	CLIP-seq
MIRT1443392	hsa-miR-34c-5p	CLIP-seq
MIRT1443393	hsa-miR-4269	CLIP-seq
MIRT1443394	hsa-miR-4427	CLIP-seq
MIRT1443395	hsa-miR-4436a	CLIP-seq
MIRT1443396	hsa-miR-449a	CLIP-seq
MIRT1443397	hsa-miR-449b	CLIP-seq
MIRT1443398	hsa-miR-4514	CLIP-seq
MIRT1443399	hsa-miR-4691-3p	CLIP-seq
MIRT1443400	hsa-miR-4692	CLIP-seq
MIRT1443401	hsa-miR-4742-5p	CLIP-seq
MIRT2132689	hsa-miR-122	CLIP-seq
MIRT2132690	hsa-miR-1281	CLIP-seq
MIRT2132691	hsa-miR-1915	CLIP-seq
MIRT2132692	hsa-miR-3151	CLIP-seq
MIRT2132693	hsa-miR-342-5p	CLIP-seq
MIRT2132694	hsa-miR-378g	CLIP-seq
MIRT2132695	hsa-miR-4283	CLIP-seq
MIRT2132696	hsa-miR-433	CLIP-seq
MIRT2132697	hsa-miR-4437	CLIP-seq
MIRT2132698	hsa-miR-4489	CLIP-seq
MIRT2132699	hsa-miR-4492	CLIP-seq
MIRT2132700	hsa-miR-4498	CLIP-seq
MIRT2132701	hsa-miR-4503	CLIP-seq
MIRT2132702	hsa-miR-4505	CLIP-seq
MIRT2132703	hsa-miR-4532	CLIP-seq
MIRT2132704	hsa-miR-4651	CLIP-seq
MIRT2132705	hsa-miR-4664-5p	CLIP-seq
MIRT2132706	hsa-miR-4674	CLIP-seq
MIRT2132707	hsa-miR-548p	CLIP-seq
MIRT2132708	hsa-miR-608	CLIP-seq
MIRT2132709	hsa-miR-629	CLIP-seq
MIRT2132710	hsa-miR-762	CLIP-seq
MIRT2353730	hsa-miR-106a	CLIP-seq
MIRT2353731	hsa-miR-106b	CLIP-seq
MIRT2132689	hsa-miR-122	CLIP-seq
MIRT2353732	hsa-miR-125a-3p	CLIP-seq
MIRT2353733	hsa-miR-150	CLIP-seq
MIRT2353734	hsa-miR-17	CLIP-seq
MIRT2132691	hsa-miR-1915	CLIP-seq
MIRT2353735	hsa-miR-20a	CLIP-seq
MIRT2353736	hsa-miR-20b	CLIP-seq
MIRT2353737	hsa-miR-302a	CLIP-seq
MIRT2353738	hsa-miR-302b	CLIP-seq
MIRT2353739	hsa-miR-302c	CLIP-seq
MIRT2353740	hsa-miR-302d	CLIP-seq
MIRT2353741	hsa-miR-302e	CLIP-seq
MIRT2353742	hsa-miR-3663-5p	CLIP-seq
MIRT2353743	hsa-miR-372	CLIP-seq
MIRT2353744	hsa-miR-373	CLIP-seq
MIRT2353745	hsa-miR-3934	CLIP-seq
MIRT2353746	hsa-miR-4312	CLIP-seq
MIRT2353747	hsa-miR-4454	CLIP-seq
MIRT2353748	hsa-miR-4662a-5p	CLIP-seq
MIRT2353749	hsa-miR-4676-5p	CLIP-seq
MIRT2353750	hsa-miR-4755-3p	CLIP-seq
MIRT2353751	hsa-miR-4757-5p	CLIP-seq
MIRT2353752	hsa-miR-4763-5p	CLIP-seq
MIRT2353753	hsa-miR-512-3p	CLIP-seq
MIRT2353754	hsa-miR-519d	CLIP-seq
MIRT2353755	hsa-miR-520a-3p	CLIP-seq
MIRT2353756	hsa-miR-520b	CLIP-seq
MIRT2353757	hsa-miR-520c-3p	CLIP-seq
MIRT2353758	hsa-miR-520d-3p	CLIP-seq
MIRT2353759	hsa-miR-520e	CLIP-seq
MIRT2353760	hsa-miR-520g	CLIP-seq
MIRT2353761	hsa-miR-520h	CLIP-seq
MIRT2353762	hsa-miR-575	CLIP-seq
MIRT2353763	hsa-miR-764	CLIP-seq
MIRT2353764	hsa-miR-93	CLIP-seq
MIRT2462092	hsa-miR-1273f	CLIP-seq
MIRT2462093	hsa-miR-411	CLIP-seq
MIRT1443393	hsa-miR-4269	CLIP-seq
MIRT2462094	hsa-miR-940	CLIP-seq
MIRT2462092	hsa-miR-1273f	CLIP-seq
MIRT2462093	hsa-miR-411	CLIP-seq
MIRT2647870	hsa-miR-1179	CLIP-seq
MIRT2132689	hsa-miR-122	CLIP-seq
MIRT2132690	hsa-miR-1281	CLIP-seq
MIRT2647871	hsa-miR-1307	CLIP-seq
MIRT2647872	hsa-miR-18a	CLIP-seq
MIRT2647873	hsa-miR-18b	CLIP-seq
MIRT2132691	hsa-miR-1915	CLIP-seq
MIRT2647874	hsa-miR-2114	CLIP-seq
MIRT1443389	hsa-miR-3157-5p	CLIP-seq
MIRT2647875	hsa-miR-323-5p	CLIP-seq
MIRT2647876	hsa-miR-370	CLIP-seq
MIRT1443393	hsa-miR-4269	CLIP-seq
MIRT2132695	hsa-miR-4283	CLIP-seq
MIRT2647877	hsa-miR-4284	CLIP-seq
MIRT2132698	hsa-miR-4489	CLIP-seq
MIRT2132703	hsa-miR-4532	CLIP-seq
MIRT2647878	hsa-miR-4536	CLIP-seq
MIRT1443399	hsa-miR-4691-3p	CLIP-seq
MIRT2647879	hsa-miR-4731-5p	CLIP-seq
MIRT2647880	hsa-miR-4735-3p	CLIP-seq
MIRT2353752	hsa-miR-4763-5p	CLIP-seq
MIRT2647881	hsa-miR-4772-3p	CLIP-seq
MIRT2647882	hsa-miR-550a	CLIP-seq
MIRT2647883	hsa-miR-876-3p	CLIP-seq
MIRT2462094	hsa-miR-940	CLIP-seq
MIRT2647870	hsa-miR-1179	CLIP-seq
MIRT2462092	hsa-miR-1273f	CLIP-seq
MIRT1443389	hsa-miR-3157-5p	CLIP-seq
MIRT2647875	hsa-miR-323-5p	CLIP-seq
MIRT2462093	hsa-miR-411	CLIP-seq
MIRT1443393	hsa-miR-4269	CLIP-seq
MIRT2647878	hsa-miR-4536	CLIP-seq
MIRT1443399	hsa-miR-4691-3p	CLIP-seq
MIRT2647883	hsa-miR-876-3p	CLIP-seq
MIRT2462094	hsa-miR-940	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
ETS1	Activation	12215452
NFKB1	Unknown	21243522
RELA	Unknown	21243522
SP1	Activation	12215452

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	12393901
GO:0005102	Function	Signaling receptor binding	TAS	9462508
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	9462508, 10318773, 21300286, 25087510, 26977880, 27152329, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	TAS	10799510
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	NAS	12393901
GO:0007165	Process	Signal transduction	TAS	9560343, 10799510
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0010818	Process	T cell chemotaxis	IEA
GO:0010820	Process	Positive regulation of T cell chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0031295	Process	T cell costimulation	IDA	10754304
GO:0031295	Process	T cell costimulation	IEA
GO:0042098	Process	T cell proliferation	NAS	9765287
GO:0042110	Process	T cell activation	NAS	12393901
GO:0042802	Function	Identical protein binding	IPI	25087510
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	12393901
GO:0043029	Process	T cell homeostasis	NAS	12393901
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	12393901
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA

MIM	HGNC	e!Ensembl
604520	11930	ENSG00000125735

O43557

Protein name

Tumor necrosis factor ligand superfamily member 14 (Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form; Tumor necrosis factor

Protein function

Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:10754304, PubMed:9462508). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, le

PDB

4EN0 , 4J6G , 4KG8 , 4KGG , 4KGQ , 4RSU , 7MSG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00229	TNF	112 → 240	TNF(Tumour Necrosis Factor) family	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or

Sequence

MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Sequence length

240

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor NF-kappa B signaling pathway Herpes simplex virus 1 infection		TNFR2 non-canonical NF-kB pathway TNFs bind their physiological receptors TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (130)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Age related macular degeneration	Age-related macular degeneration	BEFREE	29160788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21072055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22775554	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22775554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	16186421, 19023130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29207654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29940819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27172975, 30943772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12816989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33329548	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29616048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29616048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27172975, 30943772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30943772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12816989, 16272360, 17426140, 19234211		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20418899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	25460501, 28992140, 29178458, 30405638, 31826304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	25460501, 30405638, 33329548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29603739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17641063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35292636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36618968, 37762031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18384455		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21904218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21904218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	25329679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	38012562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	20096889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28992140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12377186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	23601268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20067544, 30524422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15002032, 28249900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	28249900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23514280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	31300808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30943772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28642135, 30943772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30943772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28642135, 30943772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15944326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19399182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17426140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18412315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	31624936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	18320356, 25024308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	LHGDN	18320356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	25789702, 29339444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	38235898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22519595, 25789702, 29339444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29339444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16934497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16934497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19786966, 27421726, 29660782, 31388695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22519595, 25789702, 29339444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21499267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29889310, 30168175, 31109780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	28093505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36921563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31388695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	39817309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31264958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31451090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31451090, 32310827, 36341396, 40429753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29876930, 31451090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	36341396, 40429753	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	10700230, 12787566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	31624936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	22775554	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	20680227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	31300808		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	31300808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17431181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29330151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28642135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	22775554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22775554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	29730385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29616048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29616048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15634882, 15790356, 27545119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25789702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	20096889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	18320356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17390046, 18298346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29616048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16143398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20418899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	29603739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22850801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12377186, 12651068, 19426225, 19701890, 19800994, 20117833, 21904218, 28249900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21904218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28249900		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15833878, 17573614		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15833878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27421726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27172975, 29359470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25460501, 30405638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25460501, 30405638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	21833088, 24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23037546, 23895517		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	23895517	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	24076602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33968070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10700230, 12787566, 15002032, 17573614, 17641063, 17652173, 18508404, 19701890, 19716382, 19800994, 20418899, 20460520, 22850801, 23514280, 28423548, 29796164, 29861778, 29876930 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31388695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31826304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19786966, 29359470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	31264958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37024802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31199560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pigmentation Disorders	Pigmentation Disorders	BEFREE	29730385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21499267, 29315623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	11726199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12816989, 17393389, 17426140, 19380287, 20187130, 25405351, 25460501, 28253339		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18412315		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20008919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	27888155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	25789702, 29339444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29616048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	16186421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31388695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22850801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37794467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25789702, 29339444, 29616048, 30508197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	22775554	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	29616753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	39817309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TNFSF14 (TNF superfamily member 14)