CBR1 (carbonyl reductase 1)

Gene

• Entrez ID: 873
• Gene name: Carbonyl reductase 1
• Gene symbol: CBR1
• Synonyms (NCBI Gene): CBR, PG-9-KR, SDR21C1, hCBR1
• Chromosome: 21
• Chromosome location: 21q22.12
• Summary: The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT049536	hsa-miR-92a-3p	CLASH	23622248
MIRT045152	hsa-miR-186-5p	CLASH	23622248
MIRT042005	hsa-miR-484	CLASH	23622248
MIRT038897	hsa-miR-93-3p	CLASH	23622248
MIRT526062	hsa-miR-323a-3p	PAR-CLIP	22012620
MIRT526061	hsa-miR-5694	PAR-CLIP	22012620
MIRT526060	hsa-miR-3174	PAR-CLIP	22012620
MIRT526059	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT526058	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT526057	hsa-miR-1909-5p	PAR-CLIP	22012620
MIRT526056	hsa-miR-3606-5p	PAR-CLIP	22012620
MIRT526055	hsa-miR-921	PAR-CLIP	22012620
MIRT526054	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT526053	hsa-miR-3161	PAR-CLIP	22012620
MIRT526052	hsa-miR-599	PAR-CLIP	22012620
MIRT526062	hsa-miR-323a-3p	PAR-CLIP	22012620
MIRT526061	hsa-miR-5694	PAR-CLIP	22012620
MIRT526060	hsa-miR-3174	PAR-CLIP	22012620
MIRT526059	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT526058	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT526057	hsa-miR-1909-5p	PAR-CLIP	22012620
MIRT526056	hsa-miR-3606-5p	PAR-CLIP	22012620
MIRT526055	hsa-miR-921	PAR-CLIP	22012620
MIRT526054	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT526053	hsa-miR-3161	PAR-CLIP	22012620
MIRT526052	hsa-miR-599	PAR-CLIP	22012620
MIRT865731	hsa-miR-1178	CLIP-seq
MIRT865732	hsa-miR-1244	CLIP-seq
MIRT865733	hsa-miR-1277	CLIP-seq
MIRT865734	hsa-miR-323-3p	CLIP-seq
MIRT865735	hsa-miR-4275	CLIP-seq
MIRT865731	hsa-miR-1178	CLIP-seq
MIRT865732	hsa-miR-1244	CLIP-seq
MIRT865733	hsa-miR-1277	CLIP-seq
MIRT865734	hsa-miR-323-3p	CLIP-seq
MIRT1956746	hsa-miR-3660	CLIP-seq
MIRT1956747	hsa-miR-4257	CLIP-seq
MIRT865735	hsa-miR-4275	CLIP-seq
MIRT1956748	hsa-miR-4526	CLIP-seq
MIRT1956749	hsa-miR-4711-5p	CLIP-seq
MIRT2194021	hsa-miR-3145-3p	CLIP-seq
MIRT865734	hsa-miR-323-3p	CLIP-seq
MIRT2194022	hsa-miR-3606	CLIP-seq
MIRT2194023	hsa-miR-365	CLIP-seq
MIRT2194024	hsa-miR-425	CLIP-seq
MIRT865733	hsa-miR-1277	CLIP-seq
MIRT865731	hsa-miR-1178	CLIP-seq
MIRT2497391	hsa-miR-1193	CLIP-seq
MIRT865732	hsa-miR-1244	CLIP-seq
MIRT865733	hsa-miR-1277	CLIP-seq
MIRT2194021	hsa-miR-3145-3p	CLIP-seq
MIRT865734	hsa-miR-323-3p	CLIP-seq
MIRT2194022	hsa-miR-3606	CLIP-seq
MIRT2497392	hsa-miR-3619-3p	CLIP-seq
MIRT2194023	hsa-miR-365	CLIP-seq
MIRT2497393	hsa-miR-3664-3p	CLIP-seq
MIRT2497394	hsa-miR-3675-5p	CLIP-seq
MIRT2497395	hsa-miR-410	CLIP-seq
MIRT2194024	hsa-miR-425	CLIP-seq
MIRT865735	hsa-miR-4275	CLIP-seq
MIRT2497396	hsa-miR-4436a	CLIP-seq
MIRT2497397	hsa-miR-4520b-3p	CLIP-seq
MIRT2497398	hsa-miR-4529-3p	CLIP-seq
MIRT2497399	hsa-miR-4534	CLIP-seq
MIRT2497400	hsa-miR-4535	CLIP-seq
MIRT2497401	hsa-miR-4633-3p	CLIP-seq
MIRT2497402	hsa-miR-4641	CLIP-seq
MIRT2497403	hsa-miR-4677-3p	CLIP-seq
MIRT2497404	hsa-miR-4698	CLIP-seq
MIRT2497405	hsa-miR-4776-5p	CLIP-seq
MIRT2497406	hsa-miR-490-5p	CLIP-seq
MIRT2497407	hsa-miR-510	CLIP-seq
MIRT2497408	hsa-miR-624	CLIP-seq
MIRT2497409	hsa-miR-938	CLIP-seq
MIRT865731	hsa-miR-1178	CLIP-seq
MIRT2497391	hsa-miR-1193	CLIP-seq
MIRT2677471	hsa-miR-1225-3p	CLIP-seq
MIRT2677472	hsa-miR-1233	CLIP-seq
MIRT865732	hsa-miR-1244	CLIP-seq
MIRT865733	hsa-miR-1277	CLIP-seq
MIRT2194021	hsa-miR-3145-3p	CLIP-seq
MIRT865734	hsa-miR-323-3p	CLIP-seq
MIRT2194022	hsa-miR-3606	CLIP-seq
MIRT2497392	hsa-miR-3619-3p	CLIP-seq
MIRT2194023	hsa-miR-365	CLIP-seq
MIRT2497393	hsa-miR-3664-3p	CLIP-seq
MIRT2497394	hsa-miR-3675-5p	CLIP-seq
MIRT2497395	hsa-miR-410	CLIP-seq
MIRT2194024	hsa-miR-425	CLIP-seq
MIRT865735	hsa-miR-4275	CLIP-seq
MIRT2497396	hsa-miR-4436a	CLIP-seq
MIRT2497397	hsa-miR-4520b-3p	CLIP-seq
MIRT2497398	hsa-miR-4529-3p	CLIP-seq
MIRT2497399	hsa-miR-4534	CLIP-seq
MIRT2497400	hsa-miR-4535	CLIP-seq
MIRT2497401	hsa-miR-4633-3p	CLIP-seq
MIRT2497402	hsa-miR-4641	CLIP-seq
MIRT2497403	hsa-miR-4677-3p	CLIP-seq
MIRT2497404	hsa-miR-4698	CLIP-seq
MIRT2497405	hsa-miR-4776-5p	CLIP-seq
MIRT2497406	hsa-miR-490-5p	CLIP-seq
MIRT2497407	hsa-miR-510	CLIP-seq
MIRT2497408	hsa-miR-624	CLIP-seq
MIRT2497409	hsa-miR-938	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IBA
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IDA	1921984, 18449627
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IEA
GO:0004090	Function	Carbonyl reductase (NADPH) activity	TAS	9740676
GO:0005515	Function	Protein binding	IPI	26496610, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	18449627
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IEA
GO:0008211	Process	Glucocorticoid metabolic process	IDA	28878267
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IDA	28878267
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	19442656
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0042373	Process	Vitamin K metabolic process	IDA	18449627
GO:0046457	Process	Prostanoid biosynthetic process	TAS
GO:0047020	Function	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	IEA
GO:0047021	Function	15-hydroxyprostaglandin dehydrogenase (NADP+) activity	IEA
GO:0047021	Function	15-hydroxyprostaglandin dehydrogenase (NADP+) activity	ISS
GO:0050221	Function	Prostaglandin E2 9-reductase activity	EXP	7005231
GO:0050221	Function	Prostaglandin E2 9-reductase activity	IEA
GO:0050221	Function	Prostaglandin E2 9-reductase activity	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0160163	Function	S-nitrosoglutathione reductase (NADPH) activity	IEA
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	19442656

Other IDs

• MIM: 114830
• HGNC: 1548
• e!Ensembl: ENSG00000159228

Protein

• UniProt ID: P16152
• Protein name: Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.196, EC 1.1.1.197) (20-beta-hydroxysteroid dehydrogenase) (Alcohol dehydrogenase [NAD(P)+] CBR1) (EC 1.1.1.71) (NADPH-dependent carbonyl reductase 1) (
• Protein function: NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthrac
• PDB: 1WMA, 2PFG, 3BHI, 3BHJ, 3BHM, 4Z3D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00106	adh_short	6 → 152	short chain dehydrogenase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in kidney (at protein level). {ECO:0000269|PubMed:1597188}.
• Sequence:

  MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
  QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
  VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK
  KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
  TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

• Sequence length: 277

Pathways

KEGG:

Arachidonic acid metabolism
Folate biosynthesis
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - reactive oxygen species

Reactome:

Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, IRRITANT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22719067		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29113280		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10749138		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27140190		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	26287481	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26082314	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16885386, 22072156, 23385883, 25773924, 27357096, 28618256		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25003827, 25526449, 28618256	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	21178489	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22121107, 23430757	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23960441, 32917645	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19108014		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24757656	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18593902, 22531821, 24976539, 28527352		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29224225	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31568004	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25572536, 31025149		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	11016643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	22124095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	22124095	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	11016643		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31423217		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18199552, 23687300, 24699315		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34880125	Inhibit	★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Cholecystolithiasis	Pubtator	16316978	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	29649649		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26374847		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16195422	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21056497, 23717544, 28450226, 28966256, 30931980		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19470469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	21056497		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	30931980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15542609, 19010907, 23222413, 30931980		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15574495	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23442768, 23960441, 24694755, 24760190, 28402256, 30931980, 31646799	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23960441		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16195422	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23347191		★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	CTD_human_DG	25818598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15635070	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15635070		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29847139		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	39336582	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12836057, 24562808, 26374847		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	20729274, 24562808	Associate	★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	22302627	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30168128	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22499122	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27730688		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28792647		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	22416177	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	15574495, 26328486	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	23430757	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29966699		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29966699		★☆☆☆☆ Found in Text Mining only
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	31649033		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	22302627	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23442768, 24975222	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26374847		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16195422	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23347191		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29042428		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	29042428	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	26282591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	31423217		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22719067		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29141648, 36246561	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22562609		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21056497, 23954207		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21056497		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22121107	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22531821	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29113280		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29224225	Inhibit	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	BEFREE	20621164		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	22124095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16885386, 22072156, 23385883, 25773924, 27357096, 28618256		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15574495, 26328486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18593902, 22531821, 24976539, 28527352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25572536, 31025149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29224225		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29187884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20699658, 21469975		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19494278, 21856294, 23347191, 26476372, 29113280, 29117945, 31025149		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21056497, 23717544, 28450226, 28966256, 30931980		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	21056497		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19016765		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	16997128		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37775746	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	11016643		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16885386, 18593902, 20621164, 20699658, 21056497, 21469975, 21763448, 22398042, 22580984, 25526449, 25572536, 27080994, 30376862		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27730688, 29076589		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29113280		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28878267		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29117945	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	23473280, 33550138, 37226222	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthropathy, Primary Hypertrophic	Pachydermoperiostosis syndrome	BEFREE	18500342, 19306095, 19568269, 20299379, 20406614, 24533558		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25572536, 31025149		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29224225		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19820419, 29224225	Associate	★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	25048443	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39381438	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29187884		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24976539		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27561985	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29113280		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30376862		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27561985		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20699658, 21469975		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19108014	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19917058, 20093479, 22416177, 30531928	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	20299379		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	20621164		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22398042, 23347191		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20093479	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30333561	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24505358	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	29145845		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	29145845		★☆☆☆☆ Found in Text Mining only