Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8715
Gene name	Nucleolar protein 4
Gene symbol	NOL4
Synonyms (NCBI Gene)	CT125HRIHFB2255NOLP
Chromosome	18
Chromosome location	18q12.1

Show/Hide all (51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016812	hsa-miR-335-5p	Microarray	18185580
MIRT025082	hsa-miR-181a-5p	Microarray	17612493
MIRT612725	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612723	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT612724	hsa-miR-1202	HITS-CLIP	23824327
MIRT612721	hsa-miR-3972	HITS-CLIP	23824327
MIRT612722	hsa-miR-5006-5p	HITS-CLIP	23824327
MIRT612720	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT612725	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612723	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT612724	hsa-miR-1202	HITS-CLIP	23824327
MIRT612721	hsa-miR-3972	HITS-CLIP	23824327
MIRT612722	hsa-miR-5006-5p	HITS-CLIP	23824327
MIRT612720	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT756244	hsa-miR-23a-3p	Luciferase reporter assay	37372085
MIRT756254	hsa-miR-23b-3p	Luciferase reporter assay	37372085
MIRT1188600	hsa-miR-1254	CLIP-seq
MIRT1188601	hsa-miR-1910	CLIP-seq
MIRT1188602	hsa-miR-199a-3p	CLIP-seq
MIRT1188603	hsa-miR-199b-3p	CLIP-seq
MIRT1188604	hsa-miR-3116	CLIP-seq
MIRT1188605	hsa-miR-3117-3p	CLIP-seq
MIRT1188606	hsa-miR-3119	CLIP-seq
MIRT1188607	hsa-miR-3129-5p	CLIP-seq
MIRT1188608	hsa-miR-3973	CLIP-seq
MIRT1188609	hsa-miR-4254	CLIP-seq
MIRT1188610	hsa-miR-455-3p	CLIP-seq
MIRT1188611	hsa-miR-548a-5p	CLIP-seq
MIRT1188612	hsa-miR-548ab	CLIP-seq
MIRT1188613	hsa-miR-548ak	CLIP-seq
MIRT1188614	hsa-miR-548b-5p	CLIP-seq
MIRT1188615	hsa-miR-548c-5p	CLIP-seq
MIRT1188616	hsa-miR-548d-5p	CLIP-seq
MIRT1188617	hsa-miR-548h	CLIP-seq
MIRT1188618	hsa-miR-548i	CLIP-seq
MIRT1188619	hsa-miR-548j	CLIP-seq
MIRT1188620	hsa-miR-548p	CLIP-seq
MIRT1188621	hsa-miR-548w	CLIP-seq
MIRT1188622	hsa-miR-548y	CLIP-seq
MIRT1188623	hsa-miR-559	CLIP-seq
MIRT1188624	hsa-miR-651	CLIP-seq
MIRT1188625	hsa-miR-661	CLIP-seq
MIRT1188626	hsa-miR-936	CLIP-seq
MIRT2054587	hsa-miR-3942-5p	CLIP-seq
MIRT2054588	hsa-miR-4703-5p	CLIP-seq
MIRT2283733	hsa-miR-371-5p	CLIP-seq
MIRT2391629	hsa-miR-3074-3p	CLIP-seq
MIRT2391630	hsa-miR-380	CLIP-seq
MIRT2391631	hsa-miR-4433	CLIP-seq
MIRT2391632	hsa-miR-4459	CLIP-seq
MIRT2391633	hsa-miR-4768-3p	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	TAS	9813152
GO:0005515	Function	Protein binding	IPI	24722188, 25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	TAS	9813152

MIM	HGNC	e!Ensembl
603577	7870	ENSG00000101746

O94818

Protein name

Nucleolar protein 4 (Nucleolar-localized protein)

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in fetal brain, adult brain and testis. {ECO:0000269|PubMed:9813152}.

Sequence

MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSK
GFQLGQPDEVRGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETG
PNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKP
PTLVTSMIDYNMPITMAYMKHMKLQLLNSQQDEDESSIESDEFDMSDSTRMSAVNSDLSS
NLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGGTHSREMGDSNSDGKTGLEQD
EQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENGSKSPAHSYSS
YDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPI
PSHLTSAVAESILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPG
SQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQ
LSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN

Sequence length

638

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	39199284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31956659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18381458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18381458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32074080, 37352078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24337411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24337411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24337411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18381458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18381458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24337411, 25880415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25733303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34065612, 37399175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24337411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24337411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18381458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NOL4 (nucleolar protein 4)