Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8711
Gene name	Tyrosine kinase non receptor 1
Gene symbol	TNK1
Synonyms (NCBI Gene)	KOS1
Chromosome	17
Chromosome location	17p13.1
Summary	The protein encoded by this gene belongs to the tyrosine protein kinase family. Tyrosine protein kinases are important regulators of intracellular signal transduction pathways, mediating cellular proliferation, survival, and development. This gene is high

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051086	hsa-miR-16-5p	CLASH	23622248
MIRT1443684	hsa-miR-1272	CLIP-seq
MIRT1443685	hsa-miR-1322	CLIP-seq
MIRT1443686	hsa-miR-15a	CLIP-seq
MIRT1443687	hsa-miR-15b	CLIP-seq
MIRT1443688	hsa-miR-16	CLIP-seq
MIRT1443689	hsa-miR-195	CLIP-seq
MIRT1443690	hsa-miR-3171	CLIP-seq
MIRT1443691	hsa-miR-424	CLIP-seq
MIRT1443692	hsa-miR-4524	CLIP-seq
MIRT1443693	hsa-miR-4659a-3p	CLIP-seq
MIRT1443694	hsa-miR-4659b-3p	CLIP-seq
MIRT1443695	hsa-miR-4660	CLIP-seq
MIRT1443696	hsa-miR-497	CLIP-seq
MIRT1443697	hsa-miR-503	CLIP-seq
MIRT1443698	hsa-miR-646	CLIP-seq
MIRT2132766	hsa-miR-105	CLIP-seq
MIRT2132767	hsa-miR-1825	CLIP-seq
MIRT2132768	hsa-miR-199a-5p	CLIP-seq
MIRT2132769	hsa-miR-199b-5p	CLIP-seq
MIRT2132770	hsa-miR-2392	CLIP-seq
MIRT2132771	hsa-miR-338-3p	CLIP-seq
MIRT2132772	hsa-miR-4489	CLIP-seq
MIRT2132773	hsa-miR-4687-3p	CLIP-seq
MIRT2132774	hsa-miR-634	CLIP-seq
MIRT2132767	hsa-miR-1825	CLIP-seq
MIRT2132768	hsa-miR-199a-5p	CLIP-seq
MIRT2132769	hsa-miR-199b-5p	CLIP-seq
MIRT2132770	hsa-miR-2392	CLIP-seq
MIRT2353844	hsa-miR-23a	CLIP-seq
MIRT2353845	hsa-miR-23b	CLIP-seq
MIRT2353846	hsa-miR-23c	CLIP-seq
MIRT2353847	hsa-miR-4302	CLIP-seq
MIRT2132773	hsa-miR-4687-3p	CLIP-seq
MIRT2353848	hsa-miR-4717-3p	CLIP-seq
MIRT2353849	hsa-miR-644	CLIP-seq
MIRT2353850	hsa-miR-663b	CLIP-seq
MIRT2693759	hsa-miR-1285	CLIP-seq
MIRT2693760	hsa-miR-3187-5p	CLIP-seq
MIRT2693761	hsa-miR-326	CLIP-seq
MIRT2693762	hsa-miR-330-5p	CLIP-seq
MIRT2693763	hsa-miR-378g	CLIP-seq
MIRT2693764	hsa-miR-4268	CLIP-seq
MIRT2693765	hsa-miR-4437	CLIP-seq
MIRT2693766	hsa-miR-4486	CLIP-seq
MIRT2693767	hsa-miR-455-5p	CLIP-seq
MIRT2693768	hsa-miR-4674	CLIP-seq
MIRT2693769	hsa-miR-4691-5p	CLIP-seq
MIRT2693770	hsa-miR-4716-5p	CLIP-seq
MIRT2693771	hsa-miR-612	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	10873601
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	10873601
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8632913
GO:0005515	Function	Protein binding	IPI	10873601, 15778465, 25852190, 32296183, 32707033, 36931259
GO:0005524	Function	ATP binding	IDA	10873601
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	10873601
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006468	Process	Protein phosphorylation	TAS	8632913
GO:0016020	Component	Membrane	IDA	10873601
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	10873601

MIM	HGNC	e!Ensembl
608076	11940	ENSG00000174292

Q13470

Protein name

Non-receptor tyrosine-protein kinase TNK1 (EC 2.7.10.2) (CD38 negative kinase 1)

Protein function

Involved in negative regulation of cell growth. Has tumor suppressor properties. Plays a negative regulatory role in the Ras-MAPK pathway. May function in signaling pathways utilized broadly during fetal development and more selectively in adult

PDB

7T8J , 7TCY , 7TDY , 7U4W , 7U4Z , 9CPL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	116 → 377	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all umbilical cord blood, bone marrow and adult blood cell sub-populations and in several leukemia cell lines. Highly expressed in fetal blood, brain, lung, liver and kidney. Detected at lower levels in adult prostate, tes

Sequence

MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCW
APHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST
IWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWD
APPARGQRRNMPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRP
PLSSSSPQPSQPSRERLPWPKRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVEL
SVHGVTHQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCWRILEHYQWDLSAASR
YVLARP

Sequence length

666

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TNK1-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18830724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21132329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	31836585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36334623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28631188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30320600		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8632913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37847650	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	34382383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21536687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21536687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21536687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21536687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30320605		★★★★★ ★☆☆☆☆ Found in Text Mining only

TNK1 (tyrosine kinase non receptor 1)