Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8703
Gene name	Beta-1,4-galactosyltransferase 3
Gene symbol	B4GALT3
Synonyms (NCBI Gene)	beta4Gal-T3
Chromosome	1
Chromosome location	1q23.3
Summary	This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to si

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025373	hsa-miR-34a-5p	Sequencing	20371350
MIRT027543	hsa-miR-98-5p	Microarray	19088304
MIRT027885	hsa-miR-96-5p	Sequencing	20371350
MIRT045984	hsa-miR-125b-5p	CLASH	23622248
MIRT813843	hsa-miR-125a-5p	CLIP-seq
MIRT813844	hsa-miR-125b	CLIP-seq
MIRT813845	hsa-miR-1321	CLIP-seq
MIRT813846	hsa-miR-139-5p	CLIP-seq
MIRT813847	hsa-miR-1915	CLIP-seq
MIRT813848	hsa-miR-2682	CLIP-seq
MIRT813849	hsa-miR-27a	CLIP-seq
MIRT813850	hsa-miR-27b	CLIP-seq
MIRT813851	hsa-miR-3126-5p	CLIP-seq
MIRT813852	hsa-miR-3162-3p	CLIP-seq
MIRT813853	hsa-miR-338-3p	CLIP-seq
MIRT813854	hsa-miR-3618	CLIP-seq
MIRT813855	hsa-miR-365	CLIP-seq
MIRT813856	hsa-miR-3925-3p	CLIP-seq
MIRT813857	hsa-miR-4257	CLIP-seq
MIRT813858	hsa-miR-4267	CLIP-seq
MIRT813859	hsa-miR-4270	CLIP-seq
MIRT813860	hsa-miR-4300	CLIP-seq
MIRT813861	hsa-miR-4313	CLIP-seq
MIRT813862	hsa-miR-4319	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813864	hsa-miR-4441	CLIP-seq
MIRT813865	hsa-miR-449c	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813867	hsa-miR-4519	CLIP-seq
MIRT813868	hsa-miR-4530	CLIP-seq
MIRT813869	hsa-miR-455-3p	CLIP-seq
MIRT813870	hsa-miR-4633-3p	CLIP-seq
MIRT813871	hsa-miR-4640-3p	CLIP-seq
MIRT813872	hsa-miR-4700-3p	CLIP-seq
MIRT813873	hsa-miR-4739	CLIP-seq
MIRT813874	hsa-miR-4756-5p	CLIP-seq
MIRT813875	hsa-miR-513a-5p	CLIP-seq
MIRT813876	hsa-miR-920	CLIP-seq
MIRT813877	hsa-miR-940	CLIP-seq
MIRT813843	hsa-miR-125a-5p	CLIP-seq
MIRT813844	hsa-miR-125b	CLIP-seq
MIRT813878	hsa-miR-128	CLIP-seq
MIRT813847	hsa-miR-1915	CLIP-seq
MIRT813848	hsa-miR-2682	CLIP-seq
MIRT813849	hsa-miR-27a	CLIP-seq
MIRT813850	hsa-miR-27b	CLIP-seq
MIRT813853	hsa-miR-338-3p	CLIP-seq
MIRT813855	hsa-miR-365	CLIP-seq
MIRT813879	hsa-miR-3913-3p	CLIP-seq
MIRT813860	hsa-miR-4300	CLIP-seq
MIRT813862	hsa-miR-4319	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813865	hsa-miR-449c	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813870	hsa-miR-4633-3p	CLIP-seq
MIRT813880	hsa-miR-4668-3p	CLIP-seq
MIRT813881	hsa-miR-489	CLIP-seq
MIRT813875	hsa-miR-513a-5p	CLIP-seq
MIRT813876	hsa-miR-920	CLIP-seq
MIRT813877	hsa-miR-940	CLIP-seq
MIRT813851	hsa-miR-3126-5p	CLIP-seq
MIRT813852	hsa-miR-3162-3p	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813867	hsa-miR-4519	CLIP-seq
MIRT813868	hsa-miR-4530	CLIP-seq
MIRT813851	hsa-miR-3126-5p	CLIP-seq
MIRT2179511	hsa-miR-3177-3p	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813867	hsa-miR-4519	CLIP-seq
MIRT813868	hsa-miR-4530	CLIP-seq
MIRT813871	hsa-miR-4640-3p	CLIP-seq
MIRT813872	hsa-miR-4700-3p	CLIP-seq
MIRT2179512	hsa-miR-4768-3p	CLIP-seq
MIRT2179513	hsa-miR-642a	CLIP-seq
MIRT813851	hsa-miR-3126-5p	CLIP-seq
MIRT813852	hsa-miR-3162-3p	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813867	hsa-miR-4519	CLIP-seq
MIRT813878	hsa-miR-128	CLIP-seq
MIRT813846	hsa-miR-139-5p	CLIP-seq
MIRT2482944	hsa-miR-146a	CLIP-seq
MIRT2482945	hsa-miR-146b-5p	CLIP-seq
MIRT813849	hsa-miR-27a	CLIP-seq
MIRT813850	hsa-miR-27b	CLIP-seq
MIRT2482946	hsa-miR-28-5p	CLIP-seq
MIRT813851	hsa-miR-3126-5p	CLIP-seq
MIRT2482947	hsa-miR-3139	CLIP-seq
MIRT2482948	hsa-miR-3150b-3p	CLIP-seq
MIRT2482949	hsa-miR-3160-3p	CLIP-seq
MIRT813852	hsa-miR-3162-3p	CLIP-seq
MIRT2179511	hsa-miR-3177-3p	CLIP-seq
MIRT813853	hsa-miR-338-3p	CLIP-seq
MIRT813854	hsa-miR-3618	CLIP-seq
MIRT813879	hsa-miR-3913-3p	CLIP-seq
MIRT2482950	hsa-miR-3921	CLIP-seq
MIRT813856	hsa-miR-3925-3p	CLIP-seq
MIRT2482951	hsa-miR-4251	CLIP-seq
MIRT813858	hsa-miR-4267	CLIP-seq
MIRT2482952	hsa-miR-4277	CLIP-seq
MIRT2482953	hsa-miR-4329	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813867	hsa-miR-4519	CLIP-seq
MIRT813868	hsa-miR-4530	CLIP-seq
MIRT813869	hsa-miR-455-3p	CLIP-seq
MIRT813871	hsa-miR-4640-3p	CLIP-seq
MIRT2482954	hsa-miR-4653-5p	CLIP-seq
MIRT2482955	hsa-miR-4689	CLIP-seq
MIRT813872	hsa-miR-4700-3p	CLIP-seq
MIRT2179512	hsa-miR-4768-3p	CLIP-seq
MIRT2482956	hsa-miR-4773	CLIP-seq
MIRT2482957	hsa-miR-4784	CLIP-seq
MIRT813881	hsa-miR-489	CLIP-seq
MIRT813875	hsa-miR-513a-5p	CLIP-seq
MIRT2482958	hsa-miR-589	CLIP-seq
MIRT2179513	hsa-miR-642a	CLIP-seq
MIRT2482959	hsa-miR-708	CLIP-seq
MIRT813878	hsa-miR-128	CLIP-seq
MIRT813846	hsa-miR-139-5p	CLIP-seq
MIRT813849	hsa-miR-27a	CLIP-seq
MIRT813850	hsa-miR-27b	CLIP-seq
MIRT813851	hsa-miR-3126-5p	CLIP-seq
MIRT813853	hsa-miR-338-3p	CLIP-seq
MIRT813854	hsa-miR-3618	CLIP-seq
MIRT813879	hsa-miR-3913-3p	CLIP-seq
MIRT813856	hsa-miR-3925-3p	CLIP-seq
MIRT813858	hsa-miR-4267	CLIP-seq
MIRT813863	hsa-miR-4419a	CLIP-seq
MIRT813866	hsa-miR-4510	CLIP-seq
MIRT813867	hsa-miR-4519	CLIP-seq
MIRT813868	hsa-miR-4530	CLIP-seq
MIRT813869	hsa-miR-455-3p	CLIP-seq
MIRT813872	hsa-miR-4700-3p	CLIP-seq
MIRT2179512	hsa-miR-4768-3p	CLIP-seq
MIRT813881	hsa-miR-489	CLIP-seq
MIRT813875	hsa-miR-513a-5p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0003831	Function	Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IEA
GO:0003945	Function	N-acetyllactosamine synthase activity	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006682	Process	Galactosylceramide biosynthetic process	IBA
GO:0006682	Process	Galactosylceramide biosynthetic process	IDA	9405390
GO:0008378	Function	Galactosyltransferase activity	IBA
GO:0008378	Function	Galactosyltransferase activity	IDA	9405390
GO:0008378	Function	Galactosyltransferase activity	TAS	9405390
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070085	Process	Glycosylation	IBA

MIM	HGNC	e!Ensembl
604014	926	ENSG00000158850

O60512

Protein name

Beta-1,4-galactosyltransferase 3 (Beta-1,4-GalTase 3) (Beta4Gal-T3) (b4Gal-T3) (EC 2.4.1.-) (Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase) (Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase) (EC 2.4.1.38) (N-acety

Protein function

Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13733	Glyco_transf_7N	77 → 210	N-terminal region of glycosyl transferase group 7	Domain
PF02709	Glyco_transf_7C	215 → 292	N-terminal domain of galactosyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Found in various tissues. Highest expression in placenta, prostate, testis, ovary, intestine and muscle, and in fetal brain. {ECO:0000269|PubMed:9405390}.

Sequence

MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSH
LPGAPGGPPAPQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE
PRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVR
EALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSAL
TPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEEN
PHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPG
SSQAFRQEMLQRRPPARPGPLSTANHTALRGSH

Sequence length

393

Interactions

View interactions

	KEGG		Reactome
	N-Glycan biosynthesis Various types of N-glycan biosynthesis Other types of O-glycan biosynthesis Mannose type O-glycan biosynthesis Glycosaminoglycan biosynthesis - keratan sulfate Glycosphingolipid biosynthesis - lacto and neolacto series Metabolic pathways		Keratan sulfate biosynthesis N-Glycan antennae elongation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
VARIEGATE PORPHYRIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30312173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30312173		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26987623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26987623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24403309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	27900994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	27900994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30312173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26987623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26987623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23444218, 30312173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23444218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33504757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33663405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

B4GALT3 (beta-1,4-galactosyltransferase 3)