Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8697
Gene name	Cell division cycle 23
Gene symbol	CDC23
Synonyms (NCBI Gene)	ANAPC8APC8CUT23
Chromosome	5
Chromosome location	5q31.2
Summary	The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed o

338

Show/Hide all (338)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019590	hsa-miR-340-5p	Sequencing	20371350
MIRT020394	hsa-miR-29c-3p	Sequencing	20371350
MIRT025367	hsa-miR-34a-5p	Proteomics	21566225
MIRT025367	hsa-miR-34a-5p	Proteomics	21566225
MIRT027586	hsa-miR-98-5p	Microarray	19088304
MIRT031557	hsa-miR-16-5p	Proteomics	18668040
MIRT558859	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT558858	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT558857	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT020394	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT558856	hsa-miR-3938	PAR-CLIP	21572407
MIRT558855	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT095335	hsa-miR-6832-3p	PAR-CLIP	21572407
MIRT558854	hsa-miR-6072	PAR-CLIP	21572407
MIRT558853	hsa-miR-6891-3p	PAR-CLIP	21572407
MIRT558852	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT558851	hsa-miR-5695	PAR-CLIP	21572407
MIRT558850	hsa-miR-3663-3p	PAR-CLIP	21572407
MIRT558849	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT558848	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT558847	hsa-miR-4777-3p	PAR-CLIP	21572407
MIRT095331	hsa-miR-623	PAR-CLIP	21572407
MIRT095328	hsa-miR-204-5p	PAR-CLIP	21572407
MIRT095329	hsa-miR-211-5p	PAR-CLIP	21572407
MIRT095308	hsa-miR-4777-5p	PAR-CLIP	21572407
MIRT558846	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT558845	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT558844	hsa-miR-4755-5p	PAR-CLIP	21572407
MIRT558843	hsa-miR-5006-3p	PAR-CLIP	21572407
MIRT558859	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT558858	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT558857	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT020394	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT558856	hsa-miR-3938	PAR-CLIP	21572407
MIRT558855	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT095335	hsa-miR-6832-3p	PAR-CLIP	21572407
MIRT558854	hsa-miR-6072	PAR-CLIP	21572407
MIRT558853	hsa-miR-6891-3p	PAR-CLIP	21572407
MIRT558852	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT558851	hsa-miR-5695	PAR-CLIP	21572407
MIRT558850	hsa-miR-3663-3p	PAR-CLIP	21572407
MIRT558849	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT558848	hsa-miR-767-5p	PAR-CLIP	21572407
MIRT558847	hsa-miR-4777-3p	PAR-CLIP	21572407
MIRT095331	hsa-miR-623	PAR-CLIP	21572407
MIRT095328	hsa-miR-204-5p	PAR-CLIP	21572407
MIRT095329	hsa-miR-211-5p	PAR-CLIP	21572407
MIRT095308	hsa-miR-4777-5p	PAR-CLIP	21572407
MIRT558846	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT558845	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT558844	hsa-miR-4755-5p	PAR-CLIP	21572407
MIRT558843	hsa-miR-5006-3p	PAR-CLIP	21572407
MIRT876897	hsa-miR-1267	CLIP-seq
MIRT876898	hsa-miR-2116	CLIP-seq
MIRT876899	hsa-miR-3121-3p	CLIP-seq
MIRT876900	hsa-miR-3148	CLIP-seq
MIRT876901	hsa-miR-3647-3p	CLIP-seq
MIRT876902	hsa-miR-3678-3p	CLIP-seq
MIRT876903	hsa-miR-3682-5p	CLIP-seq
MIRT876904	hsa-miR-3689a-3p	CLIP-seq
MIRT876905	hsa-miR-3689c	CLIP-seq
MIRT876906	hsa-miR-3689d	CLIP-seq
MIRT876907	hsa-miR-4275	CLIP-seq
MIRT876908	hsa-miR-4282	CLIP-seq
MIRT876909	hsa-miR-4477a	CLIP-seq
MIRT876910	hsa-miR-4666-5p	CLIP-seq
MIRT876911	hsa-miR-4668-5p	CLIP-seq
MIRT876912	hsa-miR-4677-5p	CLIP-seq
MIRT876913	hsa-miR-4684-3p	CLIP-seq
MIRT876914	hsa-miR-4728-5p	CLIP-seq
MIRT876915	hsa-miR-4802-3p	CLIP-seq
MIRT876916	hsa-miR-4802-5p	CLIP-seq
MIRT876917	hsa-miR-488	CLIP-seq
MIRT876918	hsa-miR-561	CLIP-seq
MIRT1546305	hsa-miR-335	CLIP-seq
MIRT1546306	hsa-miR-4757-5p	CLIP-seq
MIRT1546307	hsa-miR-493	CLIP-seq
MIRT1546308	hsa-miR-548ag	CLIP-seq
MIRT1546309	hsa-miR-548ai	CLIP-seq
MIRT1959873	hsa-miR-1253	CLIP-seq
MIRT1959874	hsa-miR-3137	CLIP-seq
MIRT1959875	hsa-miR-3157-3p	CLIP-seq
MIRT1959876	hsa-miR-3166	CLIP-seq
MIRT1959877	hsa-miR-34a	CLIP-seq
MIRT1959878	hsa-miR-34c-5p	CLIP-seq
MIRT1959879	hsa-miR-3622b-5p	CLIP-seq
MIRT1959880	hsa-miR-3646	CLIP-seq
MIRT1959881	hsa-miR-3651	CLIP-seq
MIRT1959882	hsa-miR-378	CLIP-seq
MIRT1959883	hsa-miR-378b	CLIP-seq
MIRT1959884	hsa-miR-378c	CLIP-seq
MIRT1959885	hsa-miR-378d	CLIP-seq
MIRT1959886	hsa-miR-378e	CLIP-seq
MIRT1959887	hsa-miR-378f	CLIP-seq
MIRT1959888	hsa-miR-378h	CLIP-seq
MIRT1959889	hsa-miR-378i	CLIP-seq
MIRT1959890	hsa-miR-3923	CLIP-seq
MIRT1959891	hsa-miR-422a	CLIP-seq
MIRT1959892	hsa-miR-4251	CLIP-seq
MIRT1959893	hsa-miR-4290	CLIP-seq
MIRT1959894	hsa-miR-4324	CLIP-seq
MIRT1959895	hsa-miR-4423-5p	CLIP-seq
MIRT1959896	hsa-miR-449a	CLIP-seq
MIRT1959897	hsa-miR-449b	CLIP-seq
MIRT1959898	hsa-miR-4528	CLIP-seq
MIRT1959899	hsa-miR-4633-3p	CLIP-seq
MIRT1959900	hsa-miR-4638-3p	CLIP-seq
MIRT1959901	hsa-miR-4659a-5p	CLIP-seq
MIRT1959902	hsa-miR-4659b-5p	CLIP-seq
MIRT1959903	hsa-miR-4677-3p	CLIP-seq
MIRT1959904	hsa-miR-4679	CLIP-seq
MIRT1959905	hsa-miR-4776-3p	CLIP-seq
MIRT1959906	hsa-miR-4786-5p	CLIP-seq
MIRT876916	hsa-miR-4802-5p	CLIP-seq
MIRT1959907	hsa-miR-545	CLIP-seq
MIRT1959908	hsa-miR-556-3p	CLIP-seq
MIRT1959909	hsa-miR-874	CLIP-seq
MIRT1959910	hsa-miR-9	CLIP-seq
MIRT1959911	hsa-miR-922	CLIP-seq
MIRT2196863	hsa-miR-1248	CLIP-seq
MIRT1959873	hsa-miR-1253	CLIP-seq
MIRT2196864	hsa-miR-129-5p	CLIP-seq
MIRT2196865	hsa-miR-1297	CLIP-seq
MIRT2196866	hsa-miR-214	CLIP-seq
MIRT2196867	hsa-miR-223	CLIP-seq
MIRT2196868	hsa-miR-26a	CLIP-seq
MIRT2196869	hsa-miR-26b	CLIP-seq
MIRT2196870	hsa-miR-29a	CLIP-seq
MIRT2196871	hsa-miR-29b	CLIP-seq
MIRT2196872	hsa-miR-29c	CLIP-seq
MIRT2196873	hsa-miR-300	CLIP-seq
MIRT1959875	hsa-miR-3157-3p	CLIP-seq
MIRT1546305	hsa-miR-335	CLIP-seq
MIRT1959877	hsa-miR-34a	CLIP-seq
MIRT1959878	hsa-miR-34c-5p	CLIP-seq
MIRT2196874	hsa-miR-3619-5p	CLIP-seq
MIRT1959880	hsa-miR-3646	CLIP-seq
MIRT1959881	hsa-miR-3651	CLIP-seq
MIRT876903	hsa-miR-3682-5p	CLIP-seq
MIRT2196875	hsa-miR-381	CLIP-seq
MIRT1959890	hsa-miR-3923	CLIP-seq
MIRT1959892	hsa-miR-4251	CLIP-seq
MIRT2196876	hsa-miR-4272	CLIP-seq
MIRT1959893	hsa-miR-4290	CLIP-seq
MIRT2196877	hsa-miR-4291	CLIP-seq
MIRT2196878	hsa-miR-4320	CLIP-seq
MIRT1959894	hsa-miR-4324	CLIP-seq
MIRT2196879	hsa-miR-4452	CLIP-seq
MIRT2196880	hsa-miR-4465	CLIP-seq
MIRT1959896	hsa-miR-449a	CLIP-seq
MIRT1959897	hsa-miR-449b	CLIP-seq
MIRT2196881	hsa-miR-4650-5p	CLIP-seq
MIRT2196882	hsa-miR-4666-3p	CLIP-seq
MIRT1959903	hsa-miR-4677-3p	CLIP-seq
MIRT1959904	hsa-miR-4679	CLIP-seq
MIRT2196883	hsa-miR-4697-3p	CLIP-seq
MIRT2196884	hsa-miR-4715-5p	CLIP-seq
MIRT2196885	hsa-miR-4738-3p	CLIP-seq
MIRT1546306	hsa-miR-4757-5p	CLIP-seq
MIRT2196886	hsa-miR-4778-5p	CLIP-seq
MIRT1959906	hsa-miR-4786-5p	CLIP-seq
MIRT2196887	hsa-miR-4789-5p	CLIP-seq
MIRT2196888	hsa-miR-4797-3p	CLIP-seq
MIRT1546307	hsa-miR-493	CLIP-seq
MIRT2196889	hsa-miR-495	CLIP-seq
MIRT1546308	hsa-miR-548ag	CLIP-seq
MIRT1546309	hsa-miR-548ai	CLIP-seq
MIRT2196890	hsa-miR-582-3p	CLIP-seq
MIRT2196891	hsa-miR-761	CLIP-seq
MIRT2196892	hsa-miR-802	CLIP-seq
MIRT1959909	hsa-miR-874	CLIP-seq
MIRT1959911	hsa-miR-922	CLIP-seq
MIRT2196893	hsa-miR-938	CLIP-seq
MIRT2196894	hsa-miR-944	CLIP-seq
MIRT2196867	hsa-miR-223	CLIP-seq
MIRT2196873	hsa-miR-300	CLIP-seq
MIRT2385816	hsa-miR-31	CLIP-seq
MIRT876903	hsa-miR-3682-5p	CLIP-seq
MIRT2196875	hsa-miR-381	CLIP-seq
MIRT1959890	hsa-miR-3923	CLIP-seq
MIRT1959892	hsa-miR-4251	CLIP-seq
MIRT2196878	hsa-miR-4320	CLIP-seq
MIRT1959894	hsa-miR-4324	CLIP-seq
MIRT2385817	hsa-miR-4520a-3p	CLIP-seq
MIRT2385818	hsa-miR-4520b-3p	CLIP-seq
MIRT2385819	hsa-miR-4529-3p	CLIP-seq
MIRT2196882	hsa-miR-4666-3p	CLIP-seq
MIRT2196883	hsa-miR-4697-3p	CLIP-seq
MIRT2196884	hsa-miR-4715-5p	CLIP-seq
MIRT2196886	hsa-miR-4778-5p	CLIP-seq
MIRT1959906	hsa-miR-4786-5p	CLIP-seq
MIRT2196887	hsa-miR-4789-5p	CLIP-seq
MIRT2196892	hsa-miR-802	CLIP-seq
MIRT1959910	hsa-miR-9	CLIP-seq
MIRT2196894	hsa-miR-944	CLIP-seq
MIRT2446648	hsa-miR-1179	CLIP-seq
MIRT2446649	hsa-miR-3127-5p	CLIP-seq
MIRT2446650	hsa-miR-3185	CLIP-seq
MIRT2446651	hsa-miR-4270	CLIP-seq
MIRT2446652	hsa-miR-4441	CLIP-seq
MIRT2446653	hsa-miR-4493	CLIP-seq
MIRT2446654	hsa-miR-4753-5p	CLIP-seq
MIRT2446648	hsa-miR-1179	CLIP-seq
MIRT2500136	hsa-miR-1202	CLIP-seq
MIRT2500137	hsa-miR-1238	CLIP-seq
MIRT2500138	hsa-miR-1266	CLIP-seq
MIRT876897	hsa-miR-1267	CLIP-seq
MIRT2500139	hsa-miR-148a	CLIP-seq
MIRT2500140	hsa-miR-148b	CLIP-seq
MIRT2500141	hsa-miR-152	CLIP-seq
MIRT2500142	hsa-miR-204	CLIP-seq
MIRT2500143	hsa-miR-211	CLIP-seq
MIRT2196870	hsa-miR-29a	CLIP-seq
MIRT2196871	hsa-miR-29b	CLIP-seq
MIRT2196872	hsa-miR-29c	CLIP-seq
MIRT876899	hsa-miR-3121-3p	CLIP-seq
MIRT2500144	hsa-miR-3124-3p	CLIP-seq
MIRT2446649	hsa-miR-3127-5p	CLIP-seq
MIRT2500145	hsa-miR-3132	CLIP-seq
MIRT876900	hsa-miR-3148	CLIP-seq
MIRT2500146	hsa-miR-3149	CLIP-seq
MIRT2500147	hsa-miR-3156-5p	CLIP-seq
MIRT1959875	hsa-miR-3157-3p	CLIP-seq
MIRT2446650	hsa-miR-3185	CLIP-seq
MIRT2500148	hsa-miR-3194-3p	CLIP-seq
MIRT2500149	hsa-miR-3194-5p	CLIP-seq
MIRT1546305	hsa-miR-335	CLIP-seq
MIRT2500150	hsa-miR-345	CLIP-seq
MIRT876901	hsa-miR-3647-3p	CLIP-seq
MIRT876902	hsa-miR-3678-3p	CLIP-seq
MIRT876904	hsa-miR-3689a-3p	CLIP-seq
MIRT876905	hsa-miR-3689c	CLIP-seq
MIRT2500151	hsa-miR-3713	CLIP-seq
MIRT2500152	hsa-miR-371b-3p	CLIP-seq
MIRT2500153	hsa-miR-384	CLIP-seq
MIRT2500154	hsa-miR-3913-3p	CLIP-seq
MIRT2500155	hsa-miR-3929	CLIP-seq
MIRT2500156	hsa-miR-3972	CLIP-seq
MIRT2500157	hsa-miR-3974	CLIP-seq
MIRT2500158	hsa-miR-4267	CLIP-seq
MIRT2446651	hsa-miR-4270	CLIP-seq
MIRT876907	hsa-miR-4275	CLIP-seq
MIRT876908	hsa-miR-4282	CLIP-seq
MIRT2500159	hsa-miR-4419b	CLIP-seq
MIRT2446652	hsa-miR-4441	CLIP-seq
MIRT2500160	hsa-miR-4451	CLIP-seq
MIRT876909	hsa-miR-4477a	CLIP-seq
MIRT2500161	hsa-miR-4478	CLIP-seq
MIRT2500162	hsa-miR-4484	CLIP-seq
MIRT2446653	hsa-miR-4493	CLIP-seq
MIRT2500163	hsa-miR-4518	CLIP-seq
MIRT2500164	hsa-miR-4639-3p	CLIP-seq
MIRT2500165	hsa-miR-4652-3p	CLIP-seq
MIRT876911	hsa-miR-4668-5p	CLIP-seq
MIRT876913	hsa-miR-4684-3p	CLIP-seq
MIRT2500166	hsa-miR-4691-5p	CLIP-seq
MIRT876914	hsa-miR-4728-5p	CLIP-seq
MIRT2196885	hsa-miR-4738-3p	CLIP-seq
MIRT2446654	hsa-miR-4753-5p	CLIP-seq
MIRT2500167	hsa-miR-4771	CLIP-seq
MIRT2500168	hsa-miR-4778-3p	CLIP-seq
MIRT2196886	hsa-miR-4778-5p	CLIP-seq
MIRT2500169	hsa-miR-489	CLIP-seq
MIRT2500170	hsa-miR-499a-5p	CLIP-seq
MIRT2500171	hsa-miR-510	CLIP-seq
MIRT2500172	hsa-miR-512-5p	CLIP-seq
MIRT1959907	hsa-miR-545	CLIP-seq
MIRT2500173	hsa-miR-548an	CLIP-seq
MIRT2500174	hsa-miR-577	CLIP-seq
MIRT2500175	hsa-miR-579	CLIP-seq
MIRT2500176	hsa-miR-617	CLIP-seq
MIRT2500177	hsa-miR-630	CLIP-seq
MIRT2446648	hsa-miR-1179	CLIP-seq
MIRT2500136	hsa-miR-1202	CLIP-seq
MIRT2500138	hsa-miR-1266	CLIP-seq
MIRT876897	hsa-miR-1267	CLIP-seq
MIRT2500139	hsa-miR-148a	CLIP-seq
MIRT2500140	hsa-miR-148b	CLIP-seq
MIRT2500141	hsa-miR-152	CLIP-seq
MIRT2500142	hsa-miR-204	CLIP-seq
MIRT2500143	hsa-miR-211	CLIP-seq
MIRT2196870	hsa-miR-29a	CLIP-seq
MIRT2196871	hsa-miR-29b	CLIP-seq
MIRT2196872	hsa-miR-29c	CLIP-seq
MIRT876899	hsa-miR-3121-3p	CLIP-seq
MIRT2446649	hsa-miR-3127-5p	CLIP-seq
MIRT2500145	hsa-miR-3132	CLIP-seq
MIRT1959874	hsa-miR-3137	CLIP-seq
MIRT876900	hsa-miR-3148	CLIP-seq
MIRT2500146	hsa-miR-3149	CLIP-seq
MIRT2500147	hsa-miR-3156-5p	CLIP-seq
MIRT1959875	hsa-miR-3157-3p	CLIP-seq
MIRT2446650	hsa-miR-3185	CLIP-seq
MIRT2500148	hsa-miR-3194-3p	CLIP-seq
MIRT2500149	hsa-miR-3194-5p	CLIP-seq
MIRT1546305	hsa-miR-335	CLIP-seq
MIRT2500150	hsa-miR-345	CLIP-seq
MIRT876902	hsa-miR-3678-3p	CLIP-seq
MIRT876904	hsa-miR-3689a-3p	CLIP-seq
MIRT876905	hsa-miR-3689c	CLIP-seq
MIRT2500151	hsa-miR-3713	CLIP-seq
MIRT2500152	hsa-miR-371b-3p	CLIP-seq
MIRT2677821	hsa-miR-375	CLIP-seq
MIRT2500153	hsa-miR-384	CLIP-seq
MIRT2500154	hsa-miR-3913-3p	CLIP-seq
MIRT2500155	hsa-miR-3929	CLIP-seq
MIRT2500156	hsa-miR-3972	CLIP-seq
MIRT2500157	hsa-miR-3974	CLIP-seq
MIRT2500158	hsa-miR-4267	CLIP-seq
MIRT2446651	hsa-miR-4270	CLIP-seq
MIRT876907	hsa-miR-4275	CLIP-seq
MIRT2677822	hsa-miR-4317	CLIP-seq
MIRT2677823	hsa-miR-4326	CLIP-seq
MIRT2500159	hsa-miR-4419b	CLIP-seq
MIRT2446652	hsa-miR-4441	CLIP-seq
MIRT2500160	hsa-miR-4451	CLIP-seq
MIRT2500161	hsa-miR-4478	CLIP-seq
MIRT2500162	hsa-miR-4484	CLIP-seq
MIRT2446653	hsa-miR-4493	CLIP-seq
MIRT2500163	hsa-miR-4518	CLIP-seq
MIRT2500165	hsa-miR-4652-3p	CLIP-seq
MIRT876911	hsa-miR-4668-5p	CLIP-seq
MIRT876913	hsa-miR-4684-3p	CLIP-seq
MIRT876914	hsa-miR-4728-5p	CLIP-seq
MIRT2196885	hsa-miR-4738-3p	CLIP-seq
MIRT2446654	hsa-miR-4753-5p	CLIP-seq
MIRT2500168	hsa-miR-4778-3p	CLIP-seq
MIRT2196886	hsa-miR-4778-5p	CLIP-seq
MIRT2677824	hsa-miR-486-5p	CLIP-seq
MIRT2500169	hsa-miR-489	CLIP-seq
MIRT2500171	hsa-miR-510	CLIP-seq
MIRT2500172	hsa-miR-512-5p	CLIP-seq
MIRT1959907	hsa-miR-545	CLIP-seq
MIRT2500173	hsa-miR-548an	CLIP-seq
MIRT2500174	hsa-miR-577	CLIP-seq
MIRT2500175	hsa-miR-579	CLIP-seq
MIRT2500176	hsa-miR-617	CLIP-seq
MIRT2500177	hsa-miR-630	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IDA	14657031
GO:0000278	Process	Mitotic cell cycle	TAS	9790767
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	12629511
GO:0005515	Function	Protein binding	IPI	16189514, 20360068, 21516116, 23708001, 25416956, 25910212, 26496610, 26871637, 28514442, 32296183, 32814053, 33961781, 34595750, 35271311
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	14657031, 16364912, 21926987
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005680	Component	Anaphase-promoting complex	TAS	9790767
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	9790767
GO:0007080	Process	Mitotic metaphase chromosome alignment	IDA	14657031
GO:0007091	Process	Metaphase/anaphase transition of mitotic cell cycle	TAS	9790767
GO:0007096	Process	Regulation of exit from mitosis	TAS	9790767
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IDA	9790767
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IBA
GO:0051301	Process	Cell division	IBA
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
603462	1724	ENSG00000094880

Q9UJX2

Protein name

Cell division cycle protein 23 homolog (Anaphase-promoting complex subunit 8) (APC8) (Cyclosome subunit 8)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit

PDB

4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04049	ANAPC8	31 → 150	Anaphase promoting complex subunit 8 / Cdc23	Family

Sequence

MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP

Sequence length

597

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12629511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	34823491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21990323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21990323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	9790767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21990323, 9790767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21990323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21990323	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21990323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21990323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21990323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38639528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Variegate Porphyria	Variegate Porphyria	BEFREE	30846786		★★★★★ ★☆☆☆☆ Found in Text Mining only

CDC23 (cell division cycle 23)