MARCO (macrophage receptor with collagenous structure)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 8685
Gene name Macrophage receptor with collagenous structure
Gene symbol MARCO
Synonyms (NCBI Gene)
SCARA2SR-A6
Chromosome 2
Chromosome location 2q14.2
Summary The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger rec
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (32)
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding IEA
GO:0001540 Function Amyloid-beta binding ISS
GO:0001664 Function G protein-coupled receptor binding IEA
GO:0001664 Function G protein-coupled receptor binding IPI 20141570
GO:0001664 Function G protein-coupled receptor binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604870 6895 ENSG00000019169
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UEW3
Protein name Macrophage receptor MARCO (Macrophage receptor with collagenous structure) (Scavenger receptor class A member 2)
Protein function Pattern recognition receptor (PRR) which binds Gram-positive and Gram-negative bacteria (PubMed:9468508). Also plays a role in binding of unopsonized particles by alveolar macrophages (By similarity). Binds to the secretoglobin SCGB3A2 (PubMed:1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01391 Collagen 140 → 205 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 361 → 423 Collagen triple helix repeat (20 copies) Repeat
PF00530 SRCR 427 → 519 Scavenger receptor cysteine-rich domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in alveolar macrophages (at protein level). Detected in macrophages from various tissues including thymus, kidney, Kupffer cells of liver, and spleen (PubMed:9468508). {ECO:0000269|PubMed:10224290, ECO:0000269|PubMed:9468508}
Sequence 
MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGA
GLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
TWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAK
GAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPK
GETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQ
GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQ
GRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN
SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQ
IWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Sequence length 520
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Phagosome   Scavenging by Class A Receptors
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, HEPATOCELLULAR — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INTESTINAL INFECTIOUS DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (37)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 20141570 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 11315932
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis Pubtator 11315932 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Juvenile Juvenile arthritis Pubtator 27706807 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Reactive Reactive arthritis Pubtator 11315932 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 11315932, 36911710 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 37212598 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carotid Atherosclerosis Carotid Atherosclerosis BEFREE 28866086
★★★★★
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 39471066 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Chronic Obstructive Airway Disease Chronic Obstructive Pulmonary Disease BEFREE 21490276, 23154236, 25186548
★★★★★
★☆☆☆☆
Found in Text Mining only