Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8682
Gene name	Proliferation and apoptosis adaptor protein 15
Gene symbol	PEA15
Synonyms (NCBI Gene)	HMAT1HUMMAT1HMAT1MAT1HPEA-15PEDPED-PEA15PED/PEA15
Chromosome	1
Chromosome location	1q23.2
Summary	This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it

588

Show/Hide all (588)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004501	hsa-miR-212-3p	qRT-PCRLuciferase reporter assayWestern blot	20388802
MIRT004502	hsa-miR-34a-5p	Western blot	20388802
MIRT004503	hsa-miR-124-3p	Western blot	20388802
MIRT023321	hsa-miR-122-5p	Microarray	17612493
MIRT004502	hsa-miR-34a-5p	Sequencing	20371350
MIRT036926	hsa-miR-877-3p	CLASH	23622248
MIRT036926	hsa-miR-877-3p	CLASH	23622248
MIRT437647	hsa-miR-155-5p	MicroarrayqRT-PCR	22815788
MIRT004502	hsa-miR-34a-5p	MicroarrayqRT-PCR	22815788
MIRT725231	hsa-miR-3609	HITS-CLIP	19536157
MIRT725232	hsa-miR-548ah-5p	HITS-CLIP	19536157
MIRT725230	hsa-miR-106a-5p	HITS-CLIP	19536157
MIRT725229	hsa-miR-106b-5p	HITS-CLIP	19536157
MIRT725228	hsa-miR-17-5p	HITS-CLIP	19536157
MIRT725227	hsa-miR-20a-5p	HITS-CLIP	19536157
MIRT725226	hsa-miR-20b-5p	HITS-CLIP	19536157
MIRT725225	hsa-miR-519d-3p	HITS-CLIP	19536157
MIRT725224	hsa-miR-526b-3p	HITS-CLIP	19536157
MIRT725223	hsa-miR-93-5p	HITS-CLIP	19536157
MIRT725222	hsa-miR-4796-3p	HITS-CLIP	19536157
MIRT725221	hsa-miR-4323	HITS-CLIP	19536157
MIRT725220	hsa-miR-3943	HITS-CLIP	19536157
MIRT725219	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT725218	hsa-miR-3651	HITS-CLIP	19536157
MIRT725217	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT725216	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT725215	hsa-miR-5009-3p	HITS-CLIP	19536157
MIRT610730	hsa-miR-5193	HITS-CLIP	19536157
MIRT610729	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT655308	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT655309	hsa-miR-493-3p	HITS-CLIP	23824327
MIRT610730	hsa-miR-5193	HITS-CLIP	23824327
MIRT610729	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT655308	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610730	hsa-miR-5193	HITS-CLIP	23824327
MIRT610729	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610730	hsa-miR-5193	HITS-CLIP	23824327
MIRT610729	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT725231	hsa-miR-3609	HITS-CLIP	19536157
MIRT725232	hsa-miR-548ah-5p	HITS-CLIP	19536157
MIRT725230	hsa-miR-106a-5p	HITS-CLIP	19536157
MIRT725229	hsa-miR-106b-5p	HITS-CLIP	19536157
MIRT725228	hsa-miR-17-5p	HITS-CLIP	19536157
MIRT725227	hsa-miR-20a-5p	HITS-CLIP	19536157
MIRT725226	hsa-miR-20b-5p	HITS-CLIP	19536157
MIRT725225	hsa-miR-519d-3p	HITS-CLIP	19536157
MIRT725224	hsa-miR-526b-3p	HITS-CLIP	19536157
MIRT725223	hsa-miR-93-5p	HITS-CLIP	19536157
MIRT725222	hsa-miR-4796-3p	HITS-CLIP	19536157
MIRT725221	hsa-miR-4323	HITS-CLIP	19536157
MIRT725220	hsa-miR-3943	HITS-CLIP	19536157
MIRT725219	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT725218	hsa-miR-3651	HITS-CLIP	19536157
MIRT725217	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT725216	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT725215	hsa-miR-5009-3p	HITS-CLIP	19536157
MIRT610730	hsa-miR-5193	HITS-CLIP	19536157
MIRT610729	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT655308	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT655309	hsa-miR-493-3p	HITS-CLIP	23824327
MIRT610730	hsa-miR-5193	HITS-CLIP	23824327
MIRT610729	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT655308	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610730	hsa-miR-5193	HITS-CLIP	23824327
MIRT610729	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT610730	hsa-miR-5193	HITS-CLIP	23824327
MIRT610729	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT610728	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT610727	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT610726	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT1224118	hsa-miR-1	CLIP-seq
MIRT1224119	hsa-miR-1183	CLIP-seq
MIRT1224120	hsa-miR-1236	CLIP-seq
MIRT1224121	hsa-miR-1250	CLIP-seq
MIRT1224122	hsa-miR-1257	CLIP-seq
MIRT1224123	hsa-miR-1266	CLIP-seq
MIRT1224124	hsa-miR-1293	CLIP-seq
MIRT1224125	hsa-miR-1324	CLIP-seq
MIRT1224126	hsa-miR-141	CLIP-seq
MIRT1224127	hsa-miR-149	CLIP-seq
MIRT1224128	hsa-miR-153	CLIP-seq
MIRT1224129	hsa-miR-186	CLIP-seq
MIRT1224130	hsa-miR-1913	CLIP-seq
MIRT1224131	hsa-miR-197	CLIP-seq
MIRT1224132	hsa-miR-1973	CLIP-seq
MIRT1224133	hsa-miR-19a	CLIP-seq
MIRT1224134	hsa-miR-19b	CLIP-seq
MIRT1224135	hsa-miR-200a	CLIP-seq
MIRT1224136	hsa-miR-206	CLIP-seq
MIRT1224137	hsa-miR-2114	CLIP-seq
MIRT1224138	hsa-miR-2116	CLIP-seq
MIRT1224139	hsa-miR-216a	CLIP-seq
MIRT1224140	hsa-miR-217	CLIP-seq
MIRT1224141	hsa-miR-219-2-3p	CLIP-seq
MIRT1224142	hsa-miR-24	CLIP-seq
MIRT1224143	hsa-miR-2964a-3p	CLIP-seq
MIRT1224144	hsa-miR-3064-5p	CLIP-seq
MIRT1224145	hsa-miR-3120-3p	CLIP-seq
MIRT1224146	hsa-miR-3125	CLIP-seq
MIRT1224147	hsa-miR-3127-3p	CLIP-seq
MIRT1224148	hsa-miR-3133	CLIP-seq
MIRT1224149	hsa-miR-3150a-3p	CLIP-seq
MIRT1224150	hsa-miR-3154	CLIP-seq
MIRT1224151	hsa-miR-3155	CLIP-seq
MIRT1224152	hsa-miR-3155b	CLIP-seq
MIRT1224153	hsa-miR-3166	CLIP-seq
MIRT1224154	hsa-miR-3170	CLIP-seq
MIRT1224155	hsa-miR-3173-3p	CLIP-seq
MIRT1224156	hsa-miR-3175	CLIP-seq
MIRT1224157	hsa-miR-3183	CLIP-seq
MIRT1224158	hsa-miR-324-3p	CLIP-seq
MIRT1224159	hsa-miR-325	CLIP-seq
MIRT1224160	hsa-miR-329	CLIP-seq
MIRT1224161	hsa-miR-342-3p	CLIP-seq
MIRT1224162	hsa-miR-342-5p	CLIP-seq
MIRT1224163	hsa-miR-3607-5p	CLIP-seq
MIRT1224164	hsa-miR-362-3p	CLIP-seq
MIRT1224165	hsa-miR-3653	CLIP-seq
MIRT1224166	hsa-miR-3658	CLIP-seq
MIRT1224167	hsa-miR-3664-3p	CLIP-seq
MIRT1224168	hsa-miR-3668	CLIP-seq
MIRT1224169	hsa-miR-3672	CLIP-seq
MIRT1224170	hsa-miR-3685	CLIP-seq
MIRT1224171	hsa-miR-384	CLIP-seq
MIRT1224172	hsa-miR-3916	CLIP-seq
MIRT1224173	hsa-miR-3922-5p	CLIP-seq
MIRT1224174	hsa-miR-3925-3p	CLIP-seq
MIRT1224175	hsa-miR-3928	CLIP-seq
MIRT1224176	hsa-miR-3941	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224178	hsa-miR-409-3p	CLIP-seq
MIRT1224179	hsa-miR-412	CLIP-seq
MIRT1224180	hsa-miR-4290	CLIP-seq
MIRT1224181	hsa-miR-4329	CLIP-seq
MIRT1224182	hsa-miR-4418	CLIP-seq
MIRT1224183	hsa-miR-4428	CLIP-seq
MIRT1224184	hsa-miR-4447	CLIP-seq
MIRT1224185	hsa-miR-4450	CLIP-seq
MIRT1224186	hsa-miR-4452	CLIP-seq
MIRT1224187	hsa-miR-4472	CLIP-seq
MIRT1224188	hsa-miR-4474-5p	CLIP-seq
MIRT1224189	hsa-miR-448	CLIP-seq
MIRT1224190	hsa-miR-4481	CLIP-seq
MIRT1224191	hsa-miR-4483	CLIP-seq
MIRT1224192	hsa-miR-4488	CLIP-seq
MIRT1224193	hsa-miR-4497	CLIP-seq
MIRT1224194	hsa-miR-450b-3p	CLIP-seq
MIRT1224195	hsa-miR-4518	CLIP-seq
MIRT1224196	hsa-miR-4651	CLIP-seq
MIRT1224197	hsa-miR-4662a-3p	CLIP-seq
MIRT1224198	hsa-miR-4664-5p	CLIP-seq
MIRT1224199	hsa-miR-4666-5p	CLIP-seq
MIRT1224200	hsa-miR-4677-5p	CLIP-seq
MIRT1224201	hsa-miR-4697-5p	CLIP-seq
MIRT1224202	hsa-miR-4703-3p	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT1224204	hsa-miR-4723-3p	CLIP-seq
MIRT1224205	hsa-miR-4736	CLIP-seq
MIRT1224206	hsa-miR-4745-5p	CLIP-seq
MIRT1224207	hsa-miR-4771	CLIP-seq
MIRT1224208	hsa-miR-4773	CLIP-seq
MIRT1224209	hsa-miR-4794	CLIP-seq
MIRT1224210	hsa-miR-484	CLIP-seq
MIRT1224211	hsa-miR-491-5p	CLIP-seq
MIRT1224212	hsa-miR-509-3-5p	CLIP-seq
MIRT1224213	hsa-miR-509-5p	CLIP-seq
MIRT1224214	hsa-miR-518a-5p	CLIP-seq
MIRT1224215	hsa-miR-520a-5p	CLIP-seq
MIRT1224216	hsa-miR-525-5p	CLIP-seq
MIRT1224217	hsa-miR-527	CLIP-seq
MIRT1224218	hsa-miR-541	CLIP-seq
MIRT1224219	hsa-miR-552	CLIP-seq
MIRT1224220	hsa-miR-570	CLIP-seq
MIRT1224221	hsa-miR-603	CLIP-seq
MIRT1224222	hsa-miR-604	CLIP-seq
MIRT1224223	hsa-miR-608	CLIP-seq
MIRT1224224	hsa-miR-613	CLIP-seq
MIRT1224225	hsa-miR-628-3p	CLIP-seq
MIRT1224226	hsa-miR-638	CLIP-seq
MIRT1224227	hsa-miR-647	CLIP-seq
MIRT1224228	hsa-miR-657	CLIP-seq
MIRT1224229	hsa-miR-766	CLIP-seq
MIRT1224230	hsa-miR-769-3p	CLIP-seq
MIRT1224231	hsa-miR-889	CLIP-seq
MIRT1224232	hsa-miR-939	CLIP-seq
MIRT1224124	hsa-miR-1293	CLIP-seq
MIRT1224144	hsa-miR-3064-5p	CLIP-seq
MIRT1224154	hsa-miR-3170	CLIP-seq
MIRT1552211	hsa-miR-338-5p	CLIP-seq
MIRT1552212	hsa-miR-3665	CLIP-seq
MIRT1552213	hsa-miR-4423-5p	CLIP-seq
MIRT1224184	hsa-miR-4447	CLIP-seq
MIRT1224187	hsa-miR-4472	CLIP-seq
MIRT1224191	hsa-miR-4483	CLIP-seq
MIRT1224192	hsa-miR-4488	CLIP-seq
MIRT1224201	hsa-miR-4697-5p	CLIP-seq
MIRT1224205	hsa-miR-4736	CLIP-seq
MIRT1552214	hsa-miR-4747-5p	CLIP-seq
MIRT1552215	hsa-miR-4774-3p	CLIP-seq
MIRT1224222	hsa-miR-604	CLIP-seq
MIRT1224227	hsa-miR-647	CLIP-seq
MIRT1224228	hsa-miR-657	CLIP-seq
MIRT1552216	hsa-miR-940	CLIP-seq
MIRT1224120	hsa-miR-1236	CLIP-seq
MIRT1556779	hsa-miR-1915	CLIP-seq
MIRT1556780	hsa-miR-2115	CLIP-seq
MIRT1224148	hsa-miR-3133	CLIP-seq
MIRT1224149	hsa-miR-3150a-3p	CLIP-seq
MIRT1224153	hsa-miR-3166	CLIP-seq
MIRT1224154	hsa-miR-3170	CLIP-seq
MIRT1224156	hsa-miR-3175	CLIP-seq
MIRT1556781	hsa-miR-3184	CLIP-seq
MIRT1552212	hsa-miR-3665	CLIP-seq
MIRT1556782	hsa-miR-3689d	CLIP-seq
MIRT1556783	hsa-miR-3692	CLIP-seq
MIRT1556784	hsa-miR-4266	CLIP-seq
MIRT1556785	hsa-miR-4268	CLIP-seq
MIRT1556786	hsa-miR-4457	CLIP-seq
MIRT1556787	hsa-miR-4474-3p	CLIP-seq
MIRT1556788	hsa-miR-4496	CLIP-seq
MIRT1556789	hsa-miR-4505	CLIP-seq
MIRT1556790	hsa-miR-4695-5p	CLIP-seq
MIRT1556791	hsa-miR-4713-5p	CLIP-seq
MIRT1556792	hsa-miR-4728-5p	CLIP-seq
MIRT1552214	hsa-miR-4747-5p	CLIP-seq
MIRT1556793	hsa-miR-4779	CLIP-seq
MIRT1224211	hsa-miR-491-5p	CLIP-seq
MIRT1556794	hsa-miR-513b	CLIP-seq
MIRT1556795	hsa-miR-516a-3p	CLIP-seq
MIRT1556796	hsa-miR-544	CLIP-seq
MIRT1556797	hsa-miR-635	CLIP-seq
MIRT1224228	hsa-miR-657	CLIP-seq
MIRT1224232	hsa-miR-939	CLIP-seq
MIRT1224119	hsa-miR-1183	CLIP-seq
MIRT2065338	hsa-miR-1208	CLIP-seq
MIRT1224120	hsa-miR-1236	CLIP-seq
MIRT2065339	hsa-miR-124	CLIP-seq
MIRT1224121	hsa-miR-1250	CLIP-seq
MIRT2065340	hsa-miR-132	CLIP-seq
MIRT1224125	hsa-miR-1324	CLIP-seq
MIRT1224126	hsa-miR-141	CLIP-seq
MIRT1224127	hsa-miR-149	CLIP-seq
MIRT1224132	hsa-miR-1973	CLIP-seq
MIRT1224133	hsa-miR-19a	CLIP-seq
MIRT1224134	hsa-miR-19b	CLIP-seq
MIRT1224135	hsa-miR-200a	CLIP-seq
MIRT1224137	hsa-miR-2114	CLIP-seq
MIRT1556780	hsa-miR-2115	CLIP-seq
MIRT2065341	hsa-miR-212	CLIP-seq
MIRT1224139	hsa-miR-216a	CLIP-seq
MIRT1224141	hsa-miR-219-2-3p	CLIP-seq
MIRT1224143	hsa-miR-2964a-3p	CLIP-seq
MIRT1224144	hsa-miR-3064-5p	CLIP-seq
MIRT1224145	hsa-miR-3120-3p	CLIP-seq
MIRT1224153	hsa-miR-3166	CLIP-seq
MIRT1224154	hsa-miR-3170	CLIP-seq
MIRT2065342	hsa-miR-338-3p	CLIP-seq
MIRT1224161	hsa-miR-342-3p	CLIP-seq
MIRT1224162	hsa-miR-342-5p	CLIP-seq
MIRT1224167	hsa-miR-3664-3p	CLIP-seq
MIRT2065343	hsa-miR-3680	CLIP-seq
MIRT1556783	hsa-miR-3692	CLIP-seq
MIRT2065344	hsa-miR-3714	CLIP-seq
MIRT2065345	hsa-miR-3910	CLIP-seq
MIRT1224173	hsa-miR-3922-5p	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224182	hsa-miR-4418	CLIP-seq
MIRT1224185	hsa-miR-4450	CLIP-seq
MIRT1224186	hsa-miR-4452	CLIP-seq
MIRT1556789	hsa-miR-4505	CLIP-seq
MIRT2065346	hsa-miR-4530	CLIP-seq
MIRT1224196	hsa-miR-4651	CLIP-seq
MIRT1224197	hsa-miR-4662a-3p	CLIP-seq
MIRT1224198	hsa-miR-4664-5p	CLIP-seq
MIRT1224202	hsa-miR-4703-3p	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT1224205	hsa-miR-4736	CLIP-seq
MIRT1552214	hsa-miR-4747-5p	CLIP-seq
MIRT1224207	hsa-miR-4771	CLIP-seq
MIRT1224208	hsa-miR-4773	CLIP-seq
MIRT1552215	hsa-miR-4774-3p	CLIP-seq
MIRT1224209	hsa-miR-4794	CLIP-seq
MIRT1224211	hsa-miR-491-5p	CLIP-seq
MIRT2065347	hsa-miR-493	CLIP-seq
MIRT2065348	hsa-miR-506	CLIP-seq
MIRT1224212	hsa-miR-509-3-5p	CLIP-seq
MIRT1224213	hsa-miR-509-5p	CLIP-seq
MIRT1556795	hsa-miR-516a-3p	CLIP-seq
MIRT1224214	hsa-miR-518a-5p	CLIP-seq
MIRT1224217	hsa-miR-527	CLIP-seq
MIRT1556796	hsa-miR-544	CLIP-seq
MIRT1224220	hsa-miR-570	CLIP-seq
MIRT1224223	hsa-miR-608	CLIP-seq
MIRT2065349	hsa-miR-615-5p	CLIP-seq
MIRT2065350	hsa-miR-622	CLIP-seq
MIRT1224226	hsa-miR-638	CLIP-seq
MIRT2065351	hsa-miR-668	CLIP-seq
MIRT1552216	hsa-miR-940	CLIP-seq
MIRT2293159	hsa-miR-103a	CLIP-seq
MIRT1224119	hsa-miR-1183	CLIP-seq
MIRT2065338	hsa-miR-1208	CLIP-seq
MIRT2293160	hsa-miR-1237	CLIP-seq
MIRT2065339	hsa-miR-124	CLIP-seq
MIRT2293161	hsa-miR-1248	CLIP-seq
MIRT1224121	hsa-miR-1250	CLIP-seq
MIRT2293162	hsa-miR-1258	CLIP-seq
MIRT2293163	hsa-miR-1260	CLIP-seq
MIRT2293164	hsa-miR-1260b	CLIP-seq
MIRT2293165	hsa-miR-1280	CLIP-seq
MIRT1224124	hsa-miR-1293	CLIP-seq
MIRT2293166	hsa-miR-1303	CLIP-seq
MIRT2293167	hsa-miR-130a	CLIP-seq
MIRT2293168	hsa-miR-130b	CLIP-seq
MIRT2065340	hsa-miR-132	CLIP-seq
MIRT1224125	hsa-miR-1324	CLIP-seq
MIRT1224126	hsa-miR-141	CLIP-seq
MIRT1224127	hsa-miR-149	CLIP-seq
MIRT2293169	hsa-miR-185	CLIP-seq
MIRT2293170	hsa-miR-188-3p	CLIP-seq
MIRT1224131	hsa-miR-197	CLIP-seq
MIRT1224132	hsa-miR-1973	CLIP-seq
MIRT1224133	hsa-miR-19a	CLIP-seq
MIRT1224134	hsa-miR-19b	CLIP-seq
MIRT1224135	hsa-miR-200a	CLIP-seq
MIRT1224137	hsa-miR-2114	CLIP-seq
MIRT1224138	hsa-miR-2116	CLIP-seq
MIRT2065341	hsa-miR-212	CLIP-seq
MIRT1224139	hsa-miR-216a	CLIP-seq
MIRT1224141	hsa-miR-219-2-3p	CLIP-seq
MIRT2293171	hsa-miR-2682	CLIP-seq
MIRT1224143	hsa-miR-2964a-3p	CLIP-seq
MIRT2293172	hsa-miR-301a	CLIP-seq
MIRT2293173	hsa-miR-301b	CLIP-seq
MIRT1224144	hsa-miR-3064-5p	CLIP-seq
MIRT2293174	hsa-miR-3117-3p	CLIP-seq
MIRT1224145	hsa-miR-3120-3p	CLIP-seq
MIRT1224149	hsa-miR-3150a-3p	CLIP-seq
MIRT1224153	hsa-miR-3166	CLIP-seq
MIRT1224154	hsa-miR-3170	CLIP-seq
MIRT1224155	hsa-miR-3173-3p	CLIP-seq
MIRT1224156	hsa-miR-3175	CLIP-seq
MIRT2293175	hsa-miR-3176	CLIP-seq
MIRT1556781	hsa-miR-3184	CLIP-seq
MIRT1224160	hsa-miR-329	CLIP-seq
MIRT2065342	hsa-miR-338-3p	CLIP-seq
MIRT1224161	hsa-miR-342-3p	CLIP-seq
MIRT1224162	hsa-miR-342-5p	CLIP-seq
MIRT1224164	hsa-miR-362-3p	CLIP-seq
MIRT1552212	hsa-miR-3665	CLIP-seq
MIRT2293176	hsa-miR-3666	CLIP-seq
MIRT2065343	hsa-miR-3680	CLIP-seq
MIRT1556782	hsa-miR-3689d	CLIP-seq
MIRT2065344	hsa-miR-3714	CLIP-seq
MIRT2065345	hsa-miR-3910	CLIP-seq
MIRT2293177	hsa-miR-3922-3p	CLIP-seq
MIRT1224173	hsa-miR-3922-5p	CLIP-seq
MIRT2293178	hsa-miR-3934	CLIP-seq
MIRT2293179	hsa-miR-3936	CLIP-seq
MIRT2293180	hsa-miR-3939	CLIP-seq
MIRT1224176	hsa-miR-3941	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224179	hsa-miR-412	CLIP-seq
MIRT2293181	hsa-miR-4261	CLIP-seq
MIRT1224180	hsa-miR-4290	CLIP-seq
MIRT2293182	hsa-miR-4295	CLIP-seq
MIRT2293183	hsa-miR-4305	CLIP-seq
MIRT2293184	hsa-miR-4306	CLIP-seq
MIRT1224182	hsa-miR-4418	CLIP-seq
MIRT2293185	hsa-miR-4424	CLIP-seq
MIRT1224183	hsa-miR-4428	CLIP-seq
MIRT2293186	hsa-miR-4433	CLIP-seq
MIRT1224184	hsa-miR-4447	CLIP-seq
MIRT1224185	hsa-miR-4450	CLIP-seq
MIRT1224186	hsa-miR-4452	CLIP-seq
MIRT1556786	hsa-miR-4457	CLIP-seq
MIRT2293187	hsa-miR-4459	CLIP-seq
MIRT2293188	hsa-miR-4464	CLIP-seq
MIRT1224187	hsa-miR-4472	CLIP-seq
MIRT1224190	hsa-miR-4481	CLIP-seq
MIRT1224191	hsa-miR-4483	CLIP-seq
MIRT1224192	hsa-miR-4488	CLIP-seq
MIRT1556788	hsa-miR-4496	CLIP-seq
MIRT1224193	hsa-miR-4497	CLIP-seq
MIRT2293189	hsa-miR-449c	CLIP-seq
MIRT1556789	hsa-miR-4505	CLIP-seq
MIRT1224194	hsa-miR-450b-3p	CLIP-seq
MIRT2065346	hsa-miR-4530	CLIP-seq
MIRT2293190	hsa-miR-454	CLIP-seq
MIRT2293191	hsa-miR-455-3p	CLIP-seq
MIRT2293192	hsa-miR-4644	CLIP-seq
MIRT1224196	hsa-miR-4651	CLIP-seq
MIRT2293193	hsa-miR-4653-3p	CLIP-seq
MIRT1224197	hsa-miR-4662a-3p	CLIP-seq
MIRT1224198	hsa-miR-4664-5p	CLIP-seq
MIRT2293194	hsa-miR-4666-3p	CLIP-seq
MIRT1224200	hsa-miR-4677-5p	CLIP-seq
MIRT2293195	hsa-miR-4682	CLIP-seq
MIRT1556790	hsa-miR-4695-5p	CLIP-seq
MIRT1224201	hsa-miR-4697-5p	CLIP-seq
MIRT1224202	hsa-miR-4703-3p	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT2293196	hsa-miR-4705	CLIP-seq
MIRT2293197	hsa-miR-4709-5p	CLIP-seq
MIRT2293198	hsa-miR-4714-3p	CLIP-seq
MIRT2293199	hsa-miR-4722-5p	CLIP-seq
MIRT1556792	hsa-miR-4728-5p	CLIP-seq
MIRT2293200	hsa-miR-4731-5p	CLIP-seq
MIRT1224205	hsa-miR-4736	CLIP-seq
MIRT1224206	hsa-miR-4745-5p	CLIP-seq
MIRT1552214	hsa-miR-4747-5p	CLIP-seq
MIRT2293201	hsa-miR-4748	CLIP-seq
MIRT1224207	hsa-miR-4771	CLIP-seq
MIRT1224208	hsa-miR-4773	CLIP-seq
MIRT2293202	hsa-miR-4778-3p	CLIP-seq
MIRT1224209	hsa-miR-4794	CLIP-seq
MIRT2293203	hsa-miR-4802-3p	CLIP-seq
MIRT2293204	hsa-miR-485-5p	CLIP-seq
MIRT1224211	hsa-miR-491-5p	CLIP-seq
MIRT2065348	hsa-miR-506	CLIP-seq
MIRT1224212	hsa-miR-509-3-5p	CLIP-seq
MIRT1224213	hsa-miR-509-5p	CLIP-seq
MIRT1556794	hsa-miR-513b	CLIP-seq
MIRT1224214	hsa-miR-518a-5p	CLIP-seq
MIRT1224217	hsa-miR-527	CLIP-seq
MIRT2293205	hsa-miR-532-3p	CLIP-seq
MIRT1224218	hsa-miR-541	CLIP-seq
MIRT1224219	hsa-miR-552	CLIP-seq
MIRT1224220	hsa-miR-570	CLIP-seq
MIRT1224221	hsa-miR-603	CLIP-seq
MIRT1224222	hsa-miR-604	CLIP-seq
MIRT1224223	hsa-miR-608	CLIP-seq
MIRT2065349	hsa-miR-615-5p	CLIP-seq
MIRT2065350	hsa-miR-622	CLIP-seq
MIRT1556797	hsa-miR-635	CLIP-seq
MIRT1224226	hsa-miR-638	CLIP-seq
MIRT1224227	hsa-miR-647	CLIP-seq
MIRT2065351	hsa-miR-668	CLIP-seq
MIRT1224230	hsa-miR-769-3p	CLIP-seq
MIRT2293206	hsa-miR-933	CLIP-seq
MIRT1224232	hsa-miR-939	CLIP-seq
MIRT1552216	hsa-miR-940	CLIP-seq
MIRT1224139	hsa-miR-216a	CLIP-seq
MIRT1224145	hsa-miR-3120-3p	CLIP-seq
MIRT1224153	hsa-miR-3166	CLIP-seq
MIRT1224155	hsa-miR-3173-3p	CLIP-seq
MIRT1224161	hsa-miR-342-3p	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224183	hsa-miR-4428	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT1224211	hsa-miR-491-5p	CLIP-seq
MIRT2432096	hsa-miR-1206	CLIP-seq
MIRT2432097	hsa-miR-1283	CLIP-seq
MIRT1224124	hsa-miR-1293	CLIP-seq
MIRT2293170	hsa-miR-188-3p	CLIP-seq
MIRT1224139	hsa-miR-216a	CLIP-seq
MIRT1224145	hsa-miR-3120-3p	CLIP-seq
MIRT1224155	hsa-miR-3173-3p	CLIP-seq
MIRT1224161	hsa-miR-342-3p	CLIP-seq
MIRT2432098	hsa-miR-3545-3p	CLIP-seq
MIRT2432099	hsa-miR-3675-3p	CLIP-seq
MIRT2432100	hsa-miR-3679-3p	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224183	hsa-miR-4428	CLIP-seq
MIRT1224188	hsa-miR-4474-5p	CLIP-seq
MIRT1224190	hsa-miR-4481	CLIP-seq
MIRT1224191	hsa-miR-4483	CLIP-seq
MIRT1224197	hsa-miR-4662a-3p	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT1224205	hsa-miR-4736	CLIP-seq
MIRT1224206	hsa-miR-4745-5p	CLIP-seq
MIRT2432101	hsa-miR-4760-5p	CLIP-seq
MIRT1224218	hsa-miR-541	CLIP-seq
MIRT1224228	hsa-miR-657	CLIP-seq
MIRT2065338	hsa-miR-1208	CLIP-seq
MIRT2293161	hsa-miR-1248	CLIP-seq
MIRT2591217	hsa-miR-1256	CLIP-seq
MIRT1224122	hsa-miR-1257	CLIP-seq
MIRT2293162	hsa-miR-1258	CLIP-seq
MIRT2293163	hsa-miR-1260	CLIP-seq
MIRT2293164	hsa-miR-1260b	CLIP-seq
MIRT2591218	hsa-miR-1269	CLIP-seq
MIRT2591219	hsa-miR-1269b	CLIP-seq
MIRT2293165	hsa-miR-1280	CLIP-seq
MIRT2591220	hsa-miR-129-5p	CLIP-seq
MIRT1224140	hsa-miR-217	CLIP-seq
MIRT2591221	hsa-miR-28-3p	CLIP-seq
MIRT2293174	hsa-miR-3117-3p	CLIP-seq
MIRT1224146	hsa-miR-3125	CLIP-seq
MIRT1224147	hsa-miR-3127-3p	CLIP-seq
MIRT2293175	hsa-miR-3176	CLIP-seq
MIRT1224163	hsa-miR-3607-5p	CLIP-seq
MIRT2591222	hsa-miR-3614-3p	CLIP-seq
MIRT1224165	hsa-miR-3653	CLIP-seq
MIRT1224166	hsa-miR-3658	CLIP-seq
MIRT1224168	hsa-miR-3668	CLIP-seq
MIRT1224169	hsa-miR-3672	CLIP-seq
MIRT2591223	hsa-miR-3688-5p	CLIP-seq
MIRT2591224	hsa-miR-3908	CLIP-seq
MIRT1224172	hsa-miR-3916	CLIP-seq
MIRT2293177	hsa-miR-3922-3p	CLIP-seq
MIRT1224175	hsa-miR-3928	CLIP-seq
MIRT2293179	hsa-miR-3936	CLIP-seq
MIRT2293180	hsa-miR-3939	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224178	hsa-miR-409-3p	CLIP-seq
MIRT2591225	hsa-miR-4252	CLIP-seq
MIRT2591226	hsa-miR-4287	CLIP-seq
MIRT2293183	hsa-miR-4305	CLIP-seq
MIRT2591227	hsa-miR-4307	CLIP-seq
MIRT2591228	hsa-miR-4318	CLIP-seq
MIRT2591229	hsa-miR-4420	CLIP-seq
MIRT2591230	hsa-miR-4520b-3p	CLIP-seq
MIRT2591231	hsa-miR-4529-3p	CLIP-seq
MIRT2591232	hsa-miR-4685-3p	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT2591233	hsa-miR-4727-5p	CLIP-seq
MIRT2591234	hsa-miR-4766-3p	CLIP-seq
MIRT2591235	hsa-miR-4769-3p	CLIP-seq
MIRT2293205	hsa-miR-532-3p	CLIP-seq
MIRT1224218	hsa-miR-541	CLIP-seq
MIRT2591236	hsa-miR-556-5p	CLIP-seq
MIRT2591237	hsa-miR-610	CLIP-seq
MIRT2591238	hsa-miR-874	CLIP-seq
MIRT2293206	hsa-miR-933	CLIP-seq
MIRT2065338	hsa-miR-1208	CLIP-seq
MIRT2293161	hsa-miR-1248	CLIP-seq
MIRT2591217	hsa-miR-1256	CLIP-seq
MIRT1224122	hsa-miR-1257	CLIP-seq
MIRT2293162	hsa-miR-1258	CLIP-seq
MIRT2591218	hsa-miR-1269	CLIP-seq
MIRT2591219	hsa-miR-1269b	CLIP-seq
MIRT2591220	hsa-miR-129-5p	CLIP-seq
MIRT1224140	hsa-miR-217	CLIP-seq
MIRT2591221	hsa-miR-28-3p	CLIP-seq
MIRT2293174	hsa-miR-3117-3p	CLIP-seq
MIRT1224146	hsa-miR-3125	CLIP-seq
MIRT1224147	hsa-miR-3127-3p	CLIP-seq
MIRT1224163	hsa-miR-3607-5p	CLIP-seq
MIRT2591222	hsa-miR-3614-3p	CLIP-seq
MIRT1224165	hsa-miR-3653	CLIP-seq
MIRT1224166	hsa-miR-3658	CLIP-seq
MIRT1224168	hsa-miR-3668	CLIP-seq
MIRT1224169	hsa-miR-3672	CLIP-seq
MIRT2591223	hsa-miR-3688-5p	CLIP-seq
MIRT2591224	hsa-miR-3908	CLIP-seq
MIRT1224172	hsa-miR-3916	CLIP-seq
MIRT1224175	hsa-miR-3928	CLIP-seq
MIRT2293179	hsa-miR-3936	CLIP-seq
MIRT2293180	hsa-miR-3939	CLIP-seq
MIRT1224177	hsa-miR-3942-5p	CLIP-seq
MIRT1224178	hsa-miR-409-3p	CLIP-seq
MIRT2591225	hsa-miR-4252	CLIP-seq
MIRT2591226	hsa-miR-4287	CLIP-seq
MIRT2293183	hsa-miR-4305	CLIP-seq
MIRT2591227	hsa-miR-4307	CLIP-seq
MIRT2591228	hsa-miR-4318	CLIP-seq
MIRT2591229	hsa-miR-4420	CLIP-seq
MIRT2591230	hsa-miR-4520b-3p	CLIP-seq
MIRT2591231	hsa-miR-4529-3p	CLIP-seq
MIRT2591232	hsa-miR-4685-3p	CLIP-seq
MIRT1224203	hsa-miR-4703-5p	CLIP-seq
MIRT2591233	hsa-miR-4727-5p	CLIP-seq
MIRT2591234	hsa-miR-4766-3p	CLIP-seq
MIRT2591235	hsa-miR-4769-3p	CLIP-seq
MIRT2591236	hsa-miR-556-5p	CLIP-seq
MIRT2591237	hsa-miR-610	CLIP-seq
MIRT2293206	hsa-miR-933	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Repression	17956589

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0005515	Function	Protein binding	IPI	10442631, 17255949, 21044950, 21900206, 32296183, 33961781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005875	Component	Microtubule associated complex	NAS	8662970
GO:0006915	Process	Apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IDA	9670003
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	10442631
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA

MIM	HGNC	e!Ensembl
603434	8822	ENSG00000162734

Q15121

Protein name

Astrocytic phosphoprotein PEA-15 (15 kDa phosphoprotein enriched in astrocytes) (Phosphoprotein enriched in diabetes) (PED)

Protein function

Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity). Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptos

PDB

4IZ5 , 4IZA , 6P6B , 6P6C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01335	DED	4 → 85	Death effector domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues

Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA

Sequence length

130

Interactions

View interactions

	Reactome
			RAF-independent MAPK1/3 activation RAF/MAP kinase cascade

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (93)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Age related macular degeneration	Age-related macular degeneration	BEFREE	28153442, 29404860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	20455002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	28962011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17700518, 20455002, 27294355		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17192900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17700518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16061647, 17308092, 23543364, 25304382, 27301701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23543364, 24584939, 34907034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25796184	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	29944781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	29330176, 31845390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	29330176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25796184	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29072691, 30981109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17707548, 20388802, 28376145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19010903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17192900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23481023, 30365128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28936799, 33787596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	23604467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31733642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15561963, 17021921, 18765665, 19789852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15561963, 17021921, 18765665, 19789852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20452983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32993798, 35271662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	9670003	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10607908, 17021921, 19531639, 19789852, 20648624, 21199270, 21294846, 21780113, 28395542, 29928894, 30622421, 9670003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30317603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	20455002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	30763715	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30170442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19010903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28374859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25775393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17700518, 20455002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17700518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19432816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17700518, 20455002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17700518, 26470725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20452983, 26470725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic methionine adenosyltransferase deficiency	Hepatic Methionine Adenosyltransferase Deficiency	BEFREE	8770875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	29971754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	17347910, 8828968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21199270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	8828968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	9670003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30239959, 30240853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19539371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29072691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18284607, 31421084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25075716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	25075716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	26470725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16061647, 17308092, 23543364, 24584939, 25304382, 27301701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29072691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17707548, 20388802, 28376145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19010903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30569123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16452205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17308092, 19531639, 20455002, 20648624, 24477641, 25304382, 27301701, 28395542, 29072691, 30365128, 30477538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16061647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25304382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31733642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	10607908, 17347910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17308092, 18284607, 18516683, 19010903, 20388802, 20455002, 21895963, 22584435, 24477641, 25304382, 30569123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22213050, 24412329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24412329, 28855274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18284607, 20388802, 20648624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27301701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31421084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	22144664		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16170361, 19010903		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19010903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19010903, 23543364, 32102425, 33246486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24412329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30729535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21199270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18516683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	19789852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Pigment Epithelial Detachment	Retinal Pigment Epithelial Detachment	BEFREE	31012539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	35271662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	16044159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29438777, 31396050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30569123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28962011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16452205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16452205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16452205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22584435, 25796184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25796184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25075716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	25075716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	23382212		★★★★★ ★☆☆☆☆ Found in Text Mining only

PEA15 (proliferation and apoptosis adaptor protein 15)