BECN1 (beclin 1)

Gene

• Entrez ID: 8678
• Gene name: Beclin 1
• Gene symbol: BECN1
• Synonyms (NCBI Gene): ATG6, VPS30, beclin1
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This prote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	19535919
MIRT004509	hsa-miR-30a-5p	Reporter assay;Other	19535919
MIRT048553	hsa-miR-100-5p	CLASH	23622248
MIRT052950	hsa-miR-376b-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22248718
MIRT054119	hsa-miR-30b-5p	GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	22647547
MIRT054887	hsa-miR-216a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24481443
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	23337876
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	23337876
MIRT438873	hsa-miR-30d-5p	Luciferase reporter assay	23274497
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT438873	hsa-miR-30d-5p	Luciferase reporter assay	23274497
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT705253	hsa-miR-548e-5p	HITS-CLIP	23313552
MIRT054887	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT705252	hsa-miR-4272	HITS-CLIP	23313552
MIRT705251	hsa-miR-935	HITS-CLIP	23313552
MIRT004509	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT054119	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT728207	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT438873	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT728206	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT437983	hsa-miR-216b-5p	Luciferase reporter assay	27158405
MIRT728207	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	26209295
MIRT728207	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	26209295
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	27895792
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	27895792
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26708607
MIRT733793	hsa-miR-1249-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33732328
MIRT728206	hsa-miR-30e-5p	Luciferase reporter assay, Immunoprecipitaion (IP), ELISA	32688283
MIRT004509	hsa-miR-30a-5p	Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR	34203465
MIRT705253	hsa-miR-548e-5p	HITS-CLIP	23313552
MIRT054887	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT705252	hsa-miR-4272	HITS-CLIP	23313552
MIRT705251	hsa-miR-935	HITS-CLIP	23313552
MIRT820651	hsa-miR-1279	CLIP-seq
MIRT820652	hsa-miR-2053	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT820657	hsa-miR-548u	CLIP-seq
MIRT820658	hsa-miR-561	CLIP-seq
MIRT1942522	hsa-miR-1289	CLIP-seq
MIRT1942523	hsa-miR-1323	CLIP-seq
MIRT1942524	hsa-miR-144	CLIP-seq
MIRT1942525	hsa-miR-216b	CLIP-seq
MIRT1942526	hsa-miR-3170	CLIP-seq
MIRT1942527	hsa-miR-3653	CLIP-seq
MIRT1942528	hsa-miR-3658	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT1942531	hsa-miR-520d-5p	CLIP-seq
MIRT1942532	hsa-miR-524-5p	CLIP-seq
MIRT1942533	hsa-miR-548a-3p	CLIP-seq
MIRT1942534	hsa-miR-548e	CLIP-seq
MIRT1942535	hsa-miR-548f	CLIP-seq
MIRT1942536	hsa-miR-548o	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181301	hsa-miR-1260	CLIP-seq
MIRT2181302	hsa-miR-1260b	CLIP-seq
MIRT2181303	hsa-miR-188-3p	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT2181304	hsa-miR-3156-3p	CLIP-seq
MIRT2181305	hsa-miR-320a	CLIP-seq
MIRT2181306	hsa-miR-320b	CLIP-seq
MIRT2181307	hsa-miR-320c	CLIP-seq
MIRT2181308	hsa-miR-320d	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT2181309	hsa-miR-4429	CLIP-seq
MIRT2181310	hsa-miR-4446-5p	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT2181311	hsa-miR-4717-3p	CLIP-seq
MIRT2181312	hsa-miR-4762-5p	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT2181313	hsa-miR-498	CLIP-seq
MIRT2181314	hsa-miR-499-3p	CLIP-seq
MIRT2181315	hsa-miR-499a-3p	CLIP-seq
MIRT2181316	hsa-miR-513a-3p	CLIP-seq
MIRT1942531	hsa-miR-520d-5p	CLIP-seq
MIRT1942532	hsa-miR-524-5p	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181317	hsa-miR-576-3p	CLIP-seq
MIRT2181318	hsa-miR-616	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT1942524	hsa-miR-144	CLIP-seq
MIRT2444775	hsa-miR-3591-3p	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT2484614	hsa-miR-106a	CLIP-seq
MIRT2484615	hsa-miR-106b	CLIP-seq
MIRT2181301	hsa-miR-1260	CLIP-seq
MIRT2181302	hsa-miR-1260b	CLIP-seq
MIRT2484616	hsa-miR-1290	CLIP-seq
MIRT2484617	hsa-miR-142-5p	CLIP-seq
MIRT1942524	hsa-miR-144	CLIP-seq
MIRT2484618	hsa-miR-17	CLIP-seq
MIRT2181303	hsa-miR-188-3p	CLIP-seq
MIRT2484619	hsa-miR-20a	CLIP-seq
MIRT2484620	hsa-miR-20b	CLIP-seq
MIRT2484621	hsa-miR-2113	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT2484622	hsa-miR-30a	CLIP-seq
MIRT2484623	hsa-miR-30b	CLIP-seq
MIRT2484624	hsa-miR-30c	CLIP-seq
MIRT2484625	hsa-miR-30d	CLIP-seq
MIRT2484626	hsa-miR-30e	CLIP-seq
MIRT2484627	hsa-miR-3119	CLIP-seq
MIRT2484628	hsa-miR-3128	CLIP-seq
MIRT2484629	hsa-miR-3140-3p	CLIP-seq
MIRT2484630	hsa-miR-3145-3p	CLIP-seq
MIRT2181304	hsa-miR-3156-3p	CLIP-seq
MIRT2484631	hsa-miR-3167	CLIP-seq
MIRT2181305	hsa-miR-320a	CLIP-seq
MIRT2181306	hsa-miR-320b	CLIP-seq
MIRT2181307	hsa-miR-320c	CLIP-seq
MIRT2181308	hsa-miR-320d	CLIP-seq
MIRT2444775	hsa-miR-3591-3p	CLIP-seq
MIRT2484632	hsa-miR-3609	CLIP-seq
MIRT2484633	hsa-miR-3613-5p	CLIP-seq
MIRT2484634	hsa-miR-3622b-5p	CLIP-seq
MIRT2484635	hsa-miR-3691-5p	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT2181309	hsa-miR-4429	CLIP-seq
MIRT2484636	hsa-miR-4446-3p	CLIP-seq
MIRT2181310	hsa-miR-4446-5p	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT2484637	hsa-miR-4492	CLIP-seq
MIRT2484638	hsa-miR-4498	CLIP-seq
MIRT2484639	hsa-miR-450b-5p	CLIP-seq
MIRT2484640	hsa-miR-4511	CLIP-seq
MIRT2484641	hsa-miR-452	CLIP-seq
MIRT2484642	hsa-miR-4676-3p	CLIP-seq
MIRT2484643	hsa-miR-4685-5p	CLIP-seq
MIRT2181311	hsa-miR-4717-3p	CLIP-seq
MIRT2484644	hsa-miR-4752	CLIP-seq
MIRT2484645	hsa-miR-4775	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT2484646	hsa-miR-4796-3p	CLIP-seq
MIRT2181313	hsa-miR-498	CLIP-seq
MIRT2181314	hsa-miR-499-3p	CLIP-seq
MIRT2181315	hsa-miR-499a-3p	CLIP-seq
MIRT2181316	hsa-miR-513a-3p	CLIP-seq
MIRT2484647	hsa-miR-518a-5p	CLIP-seq
MIRT2484648	hsa-miR-519d	CLIP-seq
MIRT2484649	hsa-miR-527	CLIP-seq
MIRT2484650	hsa-miR-548ah	CLIP-seq
MIRT2484651	hsa-miR-548b-3p	CLIP-seq
MIRT2484652	hsa-miR-548t	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181317	hsa-miR-576-3p	CLIP-seq
MIRT2181318	hsa-miR-616	CLIP-seq
MIRT2484653	hsa-miR-762	CLIP-seq
MIRT2484654	hsa-miR-876-5p	CLIP-seq
MIRT2484655	hsa-miR-889	CLIP-seq
MIRT2484656	hsa-miR-93	CLIP-seq
MIRT2484614	hsa-miR-106a	CLIP-seq
MIRT2484615	hsa-miR-106b	CLIP-seq
MIRT2181301	hsa-miR-1260	CLIP-seq
MIRT2181302	hsa-miR-1260b	CLIP-seq
MIRT2484616	hsa-miR-1290	CLIP-seq
MIRT2675943	hsa-miR-1299	CLIP-seq
MIRT2484617	hsa-miR-142-5p	CLIP-seq
MIRT2484618	hsa-miR-17	CLIP-seq
MIRT2181303	hsa-miR-188-3p	CLIP-seq
MIRT2484619	hsa-miR-20a	CLIP-seq
MIRT2484620	hsa-miR-20b	CLIP-seq
MIRT2484621	hsa-miR-2113	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT2484622	hsa-miR-30a	CLIP-seq
MIRT2484623	hsa-miR-30b	CLIP-seq
MIRT2484624	hsa-miR-30c	CLIP-seq
MIRT2484625	hsa-miR-30d	CLIP-seq
MIRT2484626	hsa-miR-30e	CLIP-seq
MIRT2484627	hsa-miR-3119	CLIP-seq
MIRT2484628	hsa-miR-3128	CLIP-seq
MIRT2484629	hsa-miR-3140-3p	CLIP-seq
MIRT2484630	hsa-miR-3145-3p	CLIP-seq
MIRT2181304	hsa-miR-3156-3p	CLIP-seq
MIRT2484631	hsa-miR-3167	CLIP-seq
MIRT2181305	hsa-miR-320a	CLIP-seq
MIRT2181306	hsa-miR-320b	CLIP-seq
MIRT2181307	hsa-miR-320c	CLIP-seq
MIRT2181308	hsa-miR-320d	CLIP-seq
MIRT2484632	hsa-miR-3609	CLIP-seq
MIRT2484633	hsa-miR-3613-5p	CLIP-seq
MIRT2484634	hsa-miR-3622b-5p	CLIP-seq
MIRT2484635	hsa-miR-3691-5p	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT2675944	hsa-miR-3978	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT2181309	hsa-miR-4429	CLIP-seq
MIRT2484636	hsa-miR-4446-3p	CLIP-seq
MIRT2181310	hsa-miR-4446-5p	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT2484637	hsa-miR-4492	CLIP-seq
MIRT2484638	hsa-miR-4498	CLIP-seq
MIRT2484639	hsa-miR-450b-5p	CLIP-seq
MIRT2484640	hsa-miR-4511	CLIP-seq
MIRT2484641	hsa-miR-452	CLIP-seq
MIRT2484642	hsa-miR-4676-3p	CLIP-seq
MIRT2484643	hsa-miR-4685-5p	CLIP-seq
MIRT2181311	hsa-miR-4717-3p	CLIP-seq
MIRT2484644	hsa-miR-4752	CLIP-seq
MIRT2484645	hsa-miR-4775	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT2484646	hsa-miR-4796-3p	CLIP-seq
MIRT2181313	hsa-miR-498	CLIP-seq
MIRT2181314	hsa-miR-499-3p	CLIP-seq
MIRT2181315	hsa-miR-499a-3p	CLIP-seq
MIRT2181316	hsa-miR-513a-3p	CLIP-seq
MIRT2484647	hsa-miR-518a-5p	CLIP-seq
MIRT2484648	hsa-miR-519d	CLIP-seq
MIRT2484649	hsa-miR-527	CLIP-seq
MIRT2484650	hsa-miR-548ah	CLIP-seq
MIRT2484651	hsa-miR-548b-3p	CLIP-seq
MIRT2484652	hsa-miR-548t	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181317	hsa-miR-576-3p	CLIP-seq
MIRT2181318	hsa-miR-616	CLIP-seq
MIRT2484653	hsa-miR-762	CLIP-seq
MIRT2675945	hsa-miR-875-3p	CLIP-seq
MIRT2484654	hsa-miR-876-5p	CLIP-seq
MIRT2484655	hsa-miR-889	CLIP-seq
MIRT2484656	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
JUN	Activation	19060920

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IDA	33637724
GO:0000045	Process	Autophagosome assembly	IDA	25891078
GO:0000045	Process	Autophagosome assembly	IEA
GO:0000045	Process	Autophagosome assembly	ISS
GO:0000407	Component	Phagophore assembly site	IBA
GO:0000423	Process	Mitophagy	IBA
GO:0000423	Process	Mitophagy	IMP	23878393, 25215947
GO:0001666	Process	Response to hypoxia	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	34796041
GO:0005515	Function	Protein binding	IPI	16417406, 17446862, 17659302, 17724469, 18797192, 19050071, 19180116, 19270696, 19959994, 20562859, 20638385, 20819940, 21062745, 21139567, 21241894, 21358617, 21597469, 21962518, 22028648, 22081109, 22095288, 22493499, 22498477, 23112296, 23182941, 23197835, 23316280, 23332761, 233
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	22498477
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	23878393
GO:0005768	Component	Endosome	IDA	23878393
GO:0005768	Component	Endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005776	Component	Autophagosome	ISS	23798385
GO:0005783	Component	Endoplasmic reticulum	IDA	23878393
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006622	Process	Protein targeting to lysosome	NAS	16467569
GO:0006897	Process	Endocytosis	IEA
GO:0006914	Process	Autophagy	IDA	23629966, 25891078
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IMP	28747345
GO:0006914	Process	Autophagy	IMP	23184933, 24056303
GO:0006915	Process	Apoptotic process	IEA
GO:0006968	Process	Cellular defense response	TAS	9765397
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0007040	Process	Lysosome organization	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	23478334
GO:0007254	Process	JNK cascade	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010040	Process	Response to iron(II) ion	IEA
GO:0010288	Process	Response to lead ion	IEA
GO:0010506	Process	Regulation of autophagy	IDA	16799551, 18797192
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	21358617
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	IEA
GO:0016236	Process	Macroautophagy	ISS
GO:0016241	Process	Regulation of macroautophagy	IDA	10625637
GO:0016604	Component	Nuclear body	IDA
GO:0019901	Function	Protein kinase binding	IPI	27853422
GO:0030425	Component	Dendrite	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	25891078
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25127057
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	20208530, 20643123
GO:0032473	Component	Cytoplasmic side of mitochondrial outer membrane	IDA	23878393
GO:0032801	Process	Receptor catabolic process	IEA
GO:0032801	Process	Receptor catabolic process	IMP	20643123
GO:0032991	Component	Protein-containing complex	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034271	Component	Phosphatidylinositol 3-kinase complex, class III, type I	IBA
GO:0034272	Component	Phosphatidylinositol 3-kinase complex, class III, type II	IBA
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IEA
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IPI	25490155
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	ISS
GO:0036092	Process	Phosphatidylinositol-3-phosphate biosynthetic process	IDA	8999962
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	9765397
GO:0043069	Process	Negative regulation of programmed cell death	IMP	19273585
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	23878393
GO:0043652	Process	Engulfment of apoptotic cell	IEA
GO:0045022	Process	Early endosome to late endosome transport	IDA	14617358
GO:0045022	Process	Early endosome to late endosome transport	IMP	26783301
GO:0045324	Process	Late endosome to vacuole transport	IBA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0048666	Process	Neuron development	IEA
GO:0050435	Process	Amyloid-beta metabolic process	IEA
GO:0051020	Function	GTPase binding	IPI	25891078
GO:0051301	Process	Cell division	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051707	Process	Response to other organism	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	25215947
GO:0060090	Function	Molecular adaptor activity	IDA	34796041
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0062029	Process	Positive regulation of stress granule assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	IDA	25891078
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071275	Process	Cellular response to aluminum ion	IEA
GO:0071280	Process	Cellular response to copper ion	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0090650	Process	Cellular response to oxygen-glucose deprivation	IEA
GO:0097352	Process	Autophagosome maturation	IDA	10625637
GO:0098780	Process	Response to mitochondrial depolarisation	IMP	23878393
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	IMP	23478334
GO:1902902	Process	Negative regulation of autophagosome assembly	IEA
GO:1905672	Process	Negative regulation of lysosome organization	IEA
GO:2000786	Process	Positive regulation of autophagosome assembly	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	27031958
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	ISS

Other IDs

• MIM: 604378
• HGNC: 1034
• e!Ensembl: ENSG00000126581

Protein

• UniProt ID: Q14457
• Protein name: Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
• Protein function: Plays a central role in autophagy (PubMed:18570871, PubMed:21358617, PubMed:23184933, PubMed:23974797, PubMed:25484083, PubMed:28445460, PubMed:37776275). Acts as a core subunit of the PI3K complex that mediates formation of phosphatidylinositol
• PDB: 2P1L, 2PON, 3DVU, 4DDP, 4MI8, 5EFM, 5HHE, 5VAU, 5VAX, 5VAY, 6DCN, 6DCO, 6HOI, 6HOJ, 6HOK, 7BL1, 8SOR, 9C82, 9MHF, 9MHG, 9MHH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15285	BH3	105 → 129	Beclin-1 BH3 domain, Bcl-2-interacting	Domain
  PF17675	APG6_N	135 → 261	Apg6 coiled-coil region	Coiled-coil
  PF04111	APG6	264 → 445	Apg6 BARA domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
  ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
  DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
  QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
  LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
  NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
  WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
  SEEQWTKALKFMLTNLKWGLAWVSSQFYNK

• Sequence length: 450

Pathways

KEGG:

Autophagy - other
Mitophagy - animal
Autophagy - animal
Apoptosis - multiple species
Apelin signaling pathway
Alzheimer disease
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Pathways of neurodegeneration - multiple diseases
Shigellosis
Kaposi sarcoma-associated herpesvirus infection

Reactome:

Macroautophagy
Ub-specific processing proteases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACHADO-JOSEPH DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	26773440		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	27002764		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27002764		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31122822		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25175672, 29545906		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	BEFREE	25427639		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22301112, 27696537		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26923134, 28223119		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25482163, 31096436		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25196438		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27002764		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28757413		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	22712799, 27022243		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20559548, 26510741, 29039784, 37686098	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27737765, 29097221, 30235892, 30877973, 31243684, 31503421		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	37039144	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26810478, 30321575		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27825566		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28121485, 29344231, 30369947, 30841420		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	22712799, 27022243		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24481443, 26488467, 28777810, 29550482, 30431070, 31029709, 31237721		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	35371338	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	25649747		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28473327, 28978085, 30383396		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37793329	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23889520, 28589519		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28589519, 32446712	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21646352	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24481443, 26488467, 28777810, 29550482, 30431070, 31029709, 31237721		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33706714	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27667394, 28351336, 28693230, 29115425, 29286112, 29333604, 29344231, 29344647, 29403560, 29485914, 29719377, 30106156, 30467847, 30806286, 30923033, 31361973, 31503548, 31665034		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22301112		★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	31775562		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	33957967	Stimulate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	30034306	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23125008, 31772653		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	23666460, 34389795	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31173224		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	22275115, 25661734		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18849663, 21455500, 21861179, 22638807, 22733132, 23134379, 24141623, 25955408, 26357854, 28401970, 28881721, 29288363, 29610308, 30015871, 30476925, 30720049, 30878502, 30935019, 31102648, 31412908		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10395800, 21455500, 21861179, 25573951, 25733818, 25955408, 26218645, 26984766, 27462784, 27806347, 28351329, 30878502, 30935019, 33292020, 34525121, 34663249, 35113411	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20230646, 25639875	Inhibit	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	30236814		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	25803782	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23334926, 24132590, 24716949, 25196438, 30359544, 33649532, 36332474, 38415549	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21420796, 23192274, 23216071, 23334926, 26458502, 27683118		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	24554038, 26323347, 31096436, 35032368	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25031766	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	25955408	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14966907, 22928777, 25596085	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19298604, 23392177, 24833845, 24885292, 25032846, 26875893, 28085066, 28351336, 28521610, 29694502, 30075149, 30696802, 30964166, 31128017, 31709727, 33906303, 34120890, 35572840, 35751897, 36232407	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25031766	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23125008, 31772653		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21556768, 22481206, 23525201, 23790316, 24755562, 29024631, 29086202, 30222960, 30282915, 30362635, 30958598, 31698589		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24132590, 27249597, 29549251, 37115089	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24675697	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24998849	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25638048, 30359544, 30964104, 35571705, 35818918	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22648564	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	23936061		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18776739, 22275115, 25854363, 29219657, 29399172		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31712853		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Familial Hypertrophic 1	Cardiomyopathy	Pubtator	27432584	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	24141421		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24481443		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24481443, 36012132	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	33015765	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	34872443	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28208686	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31679456		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21623196, 21875280		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28742203		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21623196, 21875280		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27002764		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28757413		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24303007		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24303007	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30849962, 37780485, 40696630	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	30034306		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	Pubtator	30034306	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	31663994		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	21327823		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30232271		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20529838, 29346066		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29620199, 30232271		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	31663994		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22928777, 31128017		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28688896, 30187180		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30923033		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17595761, 23192274, 27559856, 28250335, 29738069, 30675309, 31092562		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	14970205		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	20876807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30675309		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20876807, 22147978, 24969889, 25196438, 26363527, 27173217, 27203674, 27444698, 27559856, 28938618, 28989537, 30806153, 30954215, 31057298, 31517637, 31631038, 31775562		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17595761		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17595761, 20842118, 22147978, 23192274, 24956373, 25156145, 25196438, 25708267, 26097572, 26163626, 26802026, 27444698, 28651493, 31057298, 31092562, 31517637, 32000660, 34131122, 34909835, 35110535, 38415549	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	19138675		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	32114389	Inhibit	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24186908, 30122942, 30359544		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30328028		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30328028		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30328028		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	28007903		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25350163, 28079883, 28982193		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28731147, 29219022, 30096432, 30292414, 30365059, 30496783, 31291980		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25386878, 27686025		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29511445, 29959950, 30017436		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38497391	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28586060, 29294366, 29511445, 29959950, 30017436		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32416353	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24750349, 26386349, 29654511, 31466264		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28624189		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29425466, 29959950		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37522124	Associate	★☆☆☆☆ Found in Text Mining only
Dowling Degos Disease	Dowling degos disease	Pubtator	25503852	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29691644		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33815277	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19921231, 26458502, 26914112, 29063947, 30186424, 30316442, 31262977		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35768796	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35992117	Associate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	31771604		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	30147831		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31823702		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29163702		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19130303	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34257544, 34955686	Associate	★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	30147831		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29435061		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24303007		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22301112, 27696537		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	31940411	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27077802		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36083487	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30316442		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31508820		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	28667867		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	31524241		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	23196876	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30190527		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21695150, 25482944, 25821789, 26582930, 31390836, 32446712	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22842577, 24535641, 26582930, 27466513, 28295288, 29843746, 30654687, 31434323		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22842577, 24535641, 25721868, 26582930, 27466513, 28295288, 29843746, 30654687, 31434323		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19451193, 19556884, 24984215, 26824182, 29278874, 29991800, 31316620		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19556884, 20638385, 27301285, 29278874, 32446712, 38067099, 39348350	Associate	★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	31108173		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	25151985		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	16718815	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	19138675		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	29451335		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24554038	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	26546165		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	35699825	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	27432584	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25265476	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	21972944	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	25649430		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16522639, 24953230		★☆☆☆☆ Found in Text Mining only
Hyperammonemia	Hyperammonemia	Pubtator	30035657	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28330474		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	26644014, 30365082, 30596897		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30002135		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	38223571	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28340591, 30972165		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	30733708		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18059169, 24818601, 25115400, 26914112, 28348069, 29278874, 30324652	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25684163, 30134829, 30355438	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36805797	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31190748		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30106100, 31519861		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	30106100	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24037090		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28688896		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	16267277	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29156793		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24303007, 30849962		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	25955408, 29552125		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28854438, 29186197		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31480863		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23765161, 31239774		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24716949, 27744427	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27002764	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	21691148	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26765290, 27002764, 27864418		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	19628769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	28777810		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17612932, 20876807, 23392173, 23392177, 23468839, 24833845, 25256671, 25427639, 25596085, 25651038, 26756998, 27929538, 28351336, 29408091, 29551896, 29740214, 29961754, 30012194, 30107804, 30579601, 31016535, 31128017, 31523192		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22928777, 31128017		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25265476	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31128017	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25265476	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25196438	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31634464		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	14966907	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25649747, 25651038		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25895534		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30106100	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	22481206, 23790316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	22481206, 24755562, 26715839, 29545906, 32576183, 35422093	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25151985		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25151985		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25151985		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25151985		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19130303, 23334926, 24303007, 25955408, 26617774	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21779982, 21861179, 23686476, 27356955, 34257544, 34955686, 37115089	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20473282, 21887344, 37566004	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31503548		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	21478185, 23801739, 27328712, 28699106, 29218765		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	31244689		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19375507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10604474, 18849663, 21455500, 21861179, 22638807, 22733132, 23134379, 24141623, 24492513, 25955408, 26357854, 28401970, 28881721, 29288363, 29610308, 30015871, 30476925, 30720049, 30878502, 30935019, 31102648, 31412908		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29288670, 30896822, 30964166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21556768, 22481206, 23525201, 23790316, 24755562, 29024631, 29086202, 30222960, 30282915, 30362635, 30958598, 31698589		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	22481206, 23790316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22275115, 25854363, 29219657, 29399172		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26134156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17786023, 24478461, 25246579, 28731173, 31534497		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23029344, 28254439, 28479384, 29163705, 29422968, 30504397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23264393, 27683118, 29908094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23125008, 31772653		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15905882, 17550384, 19524509, 20207475, 21444671, 21744334, 22835386, 24037090, 24260370, 24478461, 25132405, 25427639, 25758178, 25955408, 26357854, 26506105, 26756998, 27174920, 27459917, 27559856, 27940575, 28250335, 28253970, 28693171, 29405978, 29435061, 29552125, 29738069, 29740214, 30015871, 30654687, 30720049, 30773992, 31503548, 31608105, 31657787		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	31053152		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21623196, 21875280		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16799551, 17595761, 23192274, 27559856, 28250335, 29738069, 30675309, 31092562		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	20876807		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14970205		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20530580, 24492513		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	25487826		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28757413		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19798049, 21415575, 29219657		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21415575, 25484078	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33202207	Inhibit	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25386878, 27686025		★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	31295022		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	27679555		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26506105, 27632526	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30236814		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	38114939	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	28520695		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24971696, 29945297	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26880040, 29945297		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	18628207		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28905936, 31239774, 31399521, 31682805		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	20079142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	24141421, 29268264		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	28586060	Inhibit	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	28586060		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29306235, 35747690	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30459351, 30514592		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30459351	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	20062536, 21368883	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23936061		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16540632, 16799551, 17550384, 17595761, 17612932, 17891140, 18495205, 19524509, 19556884, 19798049, 20224296, 21327823, 21455500, 21623196, 21779982, 21861179, 22011761, 22275115, 22648564, 22733132, 22842577, 23029344, 23389729, 23935917, 24034250, 24037090, 24101526, 24133573, 24303007, 24418846, 24478461, 24535641, 24969889, 25175672, 25246579, 25427639, 25466963, 25596085, 25649430, 26239434, 26354775, 26357854, 26458502, 26506105, 26510741, 26765290, 27173217, 27203674, 27356955, 27683118, 27696537, 28401970, 28479384, 28693184, 29065135, 29163702, 29163705, 29186924, 29228741, 29359549, 29368981, 29405978, 29545906, 29610308, 29616191, 29621758, 29654866, 29997504, 30015871, 30050308, 30057310, 30066884, 30107804, 30506984, 30563569, 30664175, 30675309, 30713500, 30720049, 30784066, 30964118, 31001120, 31322140, 31744816, 31823702		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29989143		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30635843		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27846885, 28498513, 29079782, 31650158		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28498513	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25196438, 29185708, 37686098	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23801739, 29185708		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	31503548		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	18782459		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	19138675		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21779982, 23216071, 23525201, 24034250, 24260370, 24760274, 25175672, 26852748, 28158287, 29321496, 30050308, 30160218, 30184615, 30231667, 30362635, 30859368, 31232177, 31272261		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31321239		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28881721		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27837193		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28731147, 33015765	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35776529	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29115424		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	31251836	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32519067	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22275115, 24337183, 25400807, 25427639, 26708607, 27765904, 28656199, 30280766		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27499329, 30280766, 32016998	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22275115, 29399172		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	24132590	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25854363, 29219657		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10395800	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20508647, 21744334, 23270461, 23573264, 24132590, 24478461, 24675697, 25136588, 25607466, 25854363, 26239434, 26458502, 27249597, 28198375, 28537902, 29138809, 31799599, 34060285, 36008963, 36209140, 36325670, 39513923	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26134156		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21420796, 29344231		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29344231		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36835048	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	29344231		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	30597782		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28693184		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29223072, 30442917, 30821607, 31185790, 31759088		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	21420796		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	37198605	Inhibit	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	19138675		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34638836	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31056990	Stimulate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28341893		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31503548		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31657787		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	31503548		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31534497		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	36088885	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18767033, 20406981, 22799381	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34224814	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28389259, 30977401		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30122942, 30359544		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30232271		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	17998875		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	30892958		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24418846, 27421000		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	24418846, 27421000	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23178792, 30208760, 31820689		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	39528529	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	30066884	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24365867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24365867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	29361549, 29853517, 31599426		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36805797	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28977798		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28977798	Associate	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 15 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	30081747	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29259166		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21623196, 30738622, 31096436		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29163702, 29581778		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23686476, 23935917, 26095774, 27356955, 31309556, 33318468, 34769649	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29545906		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30271499		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29621758		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	23935917		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27356955, 29156523		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	19138675		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	19138675		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27077802, 31321239		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23029344, 23334926, 28254439, 28479384, 29163705, 29422968, 30472237, 30504397		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18184403		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20205286, 23029344, 23334926, 27655288, 32277647, 33627124, 33649532, 34414959	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30210141, 30363018, 30452052, 30719640		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30134829		★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine Deficiency	BEFREE	23586593		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	25487826	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23264393, 27683118, 29908094		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23264393, 27683118, 29908094		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27683118, 29908094	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	31775562		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30353470		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22638807, 23134379, 25299698, 29050003, 29288363, 30015871, 30713576, 30773992		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22638807, 26191126, 28046018, 29288363, 36939902	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29422639		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23125008	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28553083, 32116109	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	28742203	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19509586, 21875280, 22393976, 22805532, 34830185, 35057825	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28742203	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30316442		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	28849201		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	37039144	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	24452380		★☆☆☆☆ Found in Text Mining only