VAMP8 (vesicle associated membrane protein 8)

Gene

• Entrez ID: 8673
• Gene name: Vesicle associated membrane protein 8
• Gene symbol: VAMP8
• Synonyms (NCBI Gene): EDB, VAMP-8
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016522	hsa-miR-193b-3p	Microarray	20304954
MIRT016522	hsa-miR-193b-3p	Proteomics	21512034
MIRT022696	hsa-miR-124-3p	Microarray	18668037
MIRT025757	hsa-miR-7-5p	Microarray	17612493
MIRT031767	hsa-miR-16-5p	Proteomics	18668040
MIRT649546	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT649545	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT649544	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT649543	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT649542	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT649541	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT649540	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT649539	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT649538	hsa-miR-7156-3p	HITS-CLIP	23824327
MIRT649537	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT649536	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT649534	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT303877	hsa-miR-4428	PAR-CLIP	20371350
MIRT303878	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT303875	hsa-miR-3125	PAR-CLIP	20371350
MIRT303876	hsa-miR-3916	PAR-CLIP	20371350
MIRT303879	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT561100	hsa-miR-3137	PAR-CLIP	20371350
MIRT561099	hsa-miR-20b-3p	PAR-CLIP	20371350
MIRT025757	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT561098	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT561097	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT303874	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT649546	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT649545	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT649544	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT649543	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT649542	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT649541	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT649540	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT649539	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT649538	hsa-miR-7156-3p	HITS-CLIP	23824327
MIRT649537	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT649536	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT649534	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT303877	hsa-miR-4428	PAR-CLIP	20371350
MIRT303878	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT303875	hsa-miR-3125	PAR-CLIP	20371350
MIRT303876	hsa-miR-3916	PAR-CLIP	20371350
MIRT303879	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT561100	hsa-miR-3137	PAR-CLIP	20371350
MIRT561099	hsa-miR-20b-3p	PAR-CLIP	20371350
MIRT025757	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT561098	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT561097	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT303874	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT1481910	hsa-miR-103a	CLIP-seq
MIRT1481911	hsa-miR-107	CLIP-seq
MIRT1481912	hsa-miR-1179	CLIP-seq
MIRT1481913	hsa-miR-125a-5p	CLIP-seq
MIRT1481914	hsa-miR-125b	CLIP-seq
MIRT1481915	hsa-miR-15a	CLIP-seq
MIRT1481916	hsa-miR-15b	CLIP-seq
MIRT1481917	hsa-miR-16	CLIP-seq
MIRT1481918	hsa-miR-195	CLIP-seq
MIRT1481919	hsa-miR-214	CLIP-seq
MIRT1481920	hsa-miR-296-3p	CLIP-seq
MIRT1481921	hsa-miR-323b-5p	CLIP-seq
MIRT1481922	hsa-miR-3619-5p	CLIP-seq
MIRT1481923	hsa-miR-3918	CLIP-seq
MIRT1481924	hsa-miR-424	CLIP-seq
MIRT1481925	hsa-miR-4266	CLIP-seq
MIRT1481926	hsa-miR-4310	CLIP-seq
MIRT1481927	hsa-miR-4319	CLIP-seq
MIRT1481928	hsa-miR-4512	CLIP-seq
MIRT1481929	hsa-miR-4646-3p	CLIP-seq
MIRT1481930	hsa-miR-4695-5p	CLIP-seq
MIRT1481931	hsa-miR-4709-3p	CLIP-seq
MIRT1481932	hsa-miR-4729	CLIP-seq
MIRT1481933	hsa-miR-4732-3p	CLIP-seq
MIRT1481934	hsa-miR-4751	CLIP-seq
MIRT1481935	hsa-miR-4779	CLIP-seq
MIRT1481936	hsa-miR-4802-5p	CLIP-seq
MIRT1481937	hsa-miR-497	CLIP-seq
MIRT1481938	hsa-miR-670	CLIP-seq
MIRT1481939	hsa-miR-761	CLIP-seq
MIRT1481940	hsa-miR-885-3p	CLIP-seq
MIRT1481920	hsa-miR-296-3p	CLIP-seq
MIRT2144951	hsa-miR-296-5p	CLIP-seq
MIRT2144952	hsa-miR-3144-5p	CLIP-seq
MIRT1481921	hsa-miR-323b-5p	CLIP-seq
MIRT2144953	hsa-miR-3667-3p	CLIP-seq
MIRT2144954	hsa-miR-3925-3p	CLIP-seq
MIRT2144955	hsa-miR-4497	CLIP-seq
MIRT2144956	hsa-miR-4521	CLIP-seq
MIRT1481929	hsa-miR-4646-3p	CLIP-seq
MIRT2144957	hsa-miR-4690-3p	CLIP-seq
MIRT2144958	hsa-miR-4709-5p	CLIP-seq
MIRT2144959	hsa-miR-4724-3p	CLIP-seq
MIRT2144960	hsa-miR-4731-5p	CLIP-seq
MIRT1481936	hsa-miR-4802-5p	CLIP-seq
MIRT2144961	hsa-miR-766	CLIP-seq
MIRT2144951	hsa-miR-296-5p	CLIP-seq
MIRT2144954	hsa-miR-3925-3p	CLIP-seq
MIRT2144957	hsa-miR-4690-3p	CLIP-seq
MIRT2144960	hsa-miR-4731-5p	CLIP-seq
MIRT2144961	hsa-miR-766	CLIP-seq
MIRT2396780	hsa-miR-3154	CLIP-seq
MIRT2396781	hsa-miR-3665	CLIP-seq
MIRT2396782	hsa-miR-4436b-3p	CLIP-seq
MIRT1481931	hsa-miR-4709-3p	CLIP-seq
MIRT2396783	hsa-miR-4736	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005484	Function	SNAP receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	19557002, 22118466, 23217709, 25419848, 31806350, 33422265, 33947832, 33961781, 35271311, 37821429
GO:0005737	Component	Cytoplasm	IDA	18253931
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	23217709
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	TAS	9614193
GO:0005829	Component	Cytosol	IDA	22589474
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18253931
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006906	Process	Vesicle fusion	IBA
GO:0006914	Process	Autophagy	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IDA	16677249
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9614193
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016240	Process	Autophagosome membrane docking	IDA	25686604
GO:0019869	Function	Chloride channel inhibitor activity	IDA	18570918
GO:0019905	Function	Syntaxin binding	IBA
GO:0030667	Component	Secretory granule membrane	IDA	16677249
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031201	Component	SNARE complex	IBA
GO:0031201	Component	SNARE complex	IDA	12130530, 18253931, 23217709, 24550300
GO:0031201	Component	SNARE complex	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IDA	23217709
GO:0031902	Component	Late endosome membrane	IEA
GO:0031982	Component	Vesicle	IDA	18570918
GO:0035493	Process	SNARE complex assembly	IBA
GO:0035577	Component	Azurophil granule membrane	IDA	16677249
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0042589	Component	Zymogen granule membrane	IEA
GO:0043308	Process	Eosinophil degranulation	IMP	16677249
GO:0043312	Process	Neutrophil degranulation	IMP	16677249
GO:0043933	Process	Protein-containing complex organization	IEA
GO:0046718	Process	Symbiont entry into host cell	IMP	24550300
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18570918
GO:0051607	Process	Defense response to virus	IEA
GO:0055037	Component	Recycling endosome	IDA	18570918
GO:0055038	Component	Recycling endosome membrane	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070254	Process	Mucus secretion	IBA
GO:0070254	Process	Mucus secretion	IMP	22144578
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0097352	Process	Autophagosome maturation	IMP	23217709
GO:0098594	Component	Mucin granule	IBA
GO:0098594	Component	Mucin granule	IDA	22144578
GO:1903076	Process	Regulation of protein localization to plasma membrane	IDA	18570918
GO:1903531	Process	Negative regulation of secretion by cell	IDA	12130530
GO:1903595	Process	Positive regulation of histamine secretion by mast cell	IMP	18253931

Other IDs

• MIM: 603177
• HGNC: 12647
• e!Ensembl: ENSG00000118640

Protein

• UniProt ID: Q9BV40
• Protein name: Vesicle-associated membrane protein 8 (VAMP-8) (Endobrevin) (EDB)
• Protein function: SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four al
• PDB: 4WY4, 7BV6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00957	Synaptobrevin	9 → 97	Synaptobrevin	Family

• Tissue specificity: TISSUE SPECIFICITY: Platelets. {ECO:0000269|PubMed:12130530}.
• Sequence:

  MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKT
  TSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS

• Sequence length: 100

Pathways

KEGG:

SNARE interactions in vesicular transport
Autophagy - animal
Platelet activation

Reactome:

ER-Phagosome pathway
trans-Golgi Network Vesicle Budding
Lysosome Vesicle Biogenesis
Golgi Associated Vesicle Biogenesis
Neutrophil degranulation
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18073581		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18073581		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18073581	Associate	★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	30630984	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30023665, 30607161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21437235	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	28062852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30165196		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17975119		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17975119	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19752551		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24452533	Associate	★☆☆☆☆ Found in Text Mining only
Chorea Acanthocytosis Syndrome	Chorea	BEFREE	23568775		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30209331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	18073581	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22192511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	29696021		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31160616		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31714914		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31714914	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	29098081		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	28062852		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	28062852		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29696021		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30521347		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30521347		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25209430	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26191281		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33371165, 34880206	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	15372454		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	33799647	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29098081		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	34867951	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22192511		★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	30630984		★☆☆☆☆ Found in Text Mining only
Hermansky Pudlak syndrome 2	Hermansky-pudlak syndrome	Pubtator	30630984	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	20876717		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19824060		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15372454		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17595777		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30165196		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30023665, 30607161		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19824060		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30165196		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	21743467		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16308732, 16823838, 26639577, 30165196, 9307723		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16690874		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	16690874		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16823838, 19824060, 26639577, 30607161, 31374124		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15589214		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37405957	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36724221	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28242757		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30209331		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	16308732		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	21743467, 26034056, 29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25691096, 32556890	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19752551	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only