EIF3I (eukaryotic translation initiation factor 3 subunit I)

Gene

• Entrez ID: 8668
• Gene name: Eukaryotic translation initiation factor 3 subunit I
• Gene symbol: EIF3I
• Synonyms (NCBI Gene): EIF3S2, PRO2242, TRIP-1, TRIP1, eIF3-beta, eIF3-p36
• Chromosome: 1
• Chromosome location: 1p35.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016316	hsa-miR-193b-3p	Proteomics	21512034
MIRT049001	hsa-miR-92a-3p	CLASH	23622248
MIRT046640	hsa-miR-222-3p	CLASH	23622248
MIRT045793	hsa-miR-191-5p	CLASH	23622248
MIRT016316	hsa-miR-193b-3p	CLASH	23622248
MIRT040929	hsa-miR-18a-3p	CLASH	23622248
MIRT037924	hsa-miR-532-3p	CLASH	23622248
MIRT035890	hsa-miR-1303	CLASH	23622248
MIRT957601	hsa-miR-4256	CLIP-seq
MIRT957602	hsa-miR-4729	CLIP-seq
MIRT957603	hsa-miR-4786-3p	CLIP-seq
MIRT957604	hsa-miR-556-3p	CLIP-seq
MIRT1983695	hsa-miR-1200	CLIP-seq
MIRT1983696	hsa-miR-1248	CLIP-seq
MIRT1983697	hsa-miR-1270	CLIP-seq
MIRT1983698	hsa-miR-1297	CLIP-seq
MIRT1983699	hsa-miR-1323	CLIP-seq
MIRT1983700	hsa-miR-1976	CLIP-seq
MIRT1983701	hsa-miR-26a	CLIP-seq
MIRT1983702	hsa-miR-26b	CLIP-seq
MIRT957601	hsa-miR-4256	CLIP-seq
MIRT1983703	hsa-miR-4279	CLIP-seq
MIRT1983704	hsa-miR-4324	CLIP-seq
MIRT1983705	hsa-miR-4465	CLIP-seq
MIRT1983706	hsa-miR-4531	CLIP-seq
MIRT1983707	hsa-miR-4659a-3p	CLIP-seq
MIRT1983708	hsa-miR-4659b-3p	CLIP-seq
MIRT1983709	hsa-miR-4683	CLIP-seq
MIRT1983710	hsa-miR-4695-3p	CLIP-seq
MIRT1983711	hsa-miR-4722-3p	CLIP-seq
MIRT957602	hsa-miR-4729	CLIP-seq
MIRT1983712	hsa-miR-4778-3p	CLIP-seq
MIRT957603	hsa-miR-4786-3p	CLIP-seq
MIRT1983713	hsa-miR-544b	CLIP-seq
MIRT1983714	hsa-miR-548o	CLIP-seq
MIRT957604	hsa-miR-556-3p	CLIP-seq
MIRT1983715	hsa-miR-620	CLIP-seq
MIRT1983695	hsa-miR-1200	CLIP-seq
MIRT1983698	hsa-miR-1297	CLIP-seq
MIRT2218986	hsa-miR-1343	CLIP-seq
MIRT1983700	hsa-miR-1976	CLIP-seq
MIRT1983701	hsa-miR-26a	CLIP-seq
MIRT1983702	hsa-miR-26b	CLIP-seq
MIRT2218987	hsa-miR-3199	CLIP-seq
MIRT1983703	hsa-miR-4279	CLIP-seq
MIRT1983704	hsa-miR-4324	CLIP-seq
MIRT1983705	hsa-miR-4465	CLIP-seq
MIRT1983711	hsa-miR-4722-3p	CLIP-seq
MIRT1983713	hsa-miR-544b	CLIP-seq
MIRT1983695	hsa-miR-1200	CLIP-seq
MIRT2448742	hsa-miR-1254	CLIP-seq
MIRT1983698	hsa-miR-1297	CLIP-seq
MIRT2218986	hsa-miR-1343	CLIP-seq
MIRT1983700	hsa-miR-1976	CLIP-seq
MIRT1983701	hsa-miR-26a	CLIP-seq
MIRT1983702	hsa-miR-26b	CLIP-seq
MIRT2448743	hsa-miR-3116	CLIP-seq
MIRT2448744	hsa-miR-3149	CLIP-seq
MIRT2218987	hsa-miR-3199	CLIP-seq
MIRT2448745	hsa-miR-411	CLIP-seq
MIRT1983703	hsa-miR-4279	CLIP-seq
MIRT1983704	hsa-miR-4324	CLIP-seq
MIRT1983705	hsa-miR-4465	CLIP-seq
MIRT2448746	hsa-miR-4715-3p	CLIP-seq
MIRT1983711	hsa-miR-4722-3p	CLIP-seq
MIRT2448747	hsa-miR-4735-5p	CLIP-seq
MIRT2448748	hsa-miR-4775	CLIP-seq
MIRT2448749	hsa-miR-4794	CLIP-seq
MIRT1983713	hsa-miR-544b	CLIP-seq
MIRT2448750	hsa-miR-590-3p	CLIP-seq
MIRT2448751	hsa-miR-661	CLIP-seq
MIRT1983695	hsa-miR-1200	CLIP-seq
MIRT2448742	hsa-miR-1254	CLIP-seq
MIRT1983698	hsa-miR-1297	CLIP-seq
MIRT2218986	hsa-miR-1343	CLIP-seq
MIRT1983700	hsa-miR-1976	CLIP-seq
MIRT1983701	hsa-miR-26a	CLIP-seq
MIRT1983702	hsa-miR-26b	CLIP-seq
MIRT2448743	hsa-miR-3116	CLIP-seq
MIRT2448744	hsa-miR-3149	CLIP-seq
MIRT2448745	hsa-miR-411	CLIP-seq
MIRT1983703	hsa-miR-4279	CLIP-seq
MIRT1983704	hsa-miR-4324	CLIP-seq
MIRT1983705	hsa-miR-4465	CLIP-seq
MIRT2448746	hsa-miR-4715-3p	CLIP-seq
MIRT1983711	hsa-miR-4722-3p	CLIP-seq
MIRT2448747	hsa-miR-4735-5p	CLIP-seq
MIRT2448748	hsa-miR-4775	CLIP-seq
MIRT2448749	hsa-miR-4794	CLIP-seq
MIRT1983713	hsa-miR-544b	CLIP-seq
MIRT2448750	hsa-miR-590-3p	CLIP-seq
MIRT2448751	hsa-miR-661	CLIP-seq
MIRT1983695	hsa-miR-1200	CLIP-seq
MIRT2522260	hsa-miR-122	CLIP-seq
MIRT2522261	hsa-miR-1227	CLIP-seq
MIRT2448742	hsa-miR-1254	CLIP-seq
MIRT2522262	hsa-miR-125a-3p	CLIP-seq
MIRT1983698	hsa-miR-1297	CLIP-seq
MIRT2522263	hsa-miR-130a	CLIP-seq
MIRT2522264	hsa-miR-130b	CLIP-seq
MIRT2218986	hsa-miR-1343	CLIP-seq
MIRT2522265	hsa-miR-136	CLIP-seq
MIRT2522266	hsa-miR-139-3p	CLIP-seq
MIRT1983700	hsa-miR-1976	CLIP-seq
MIRT2522267	hsa-miR-2392	CLIP-seq
MIRT2522268	hsa-miR-24	CLIP-seq
MIRT1983701	hsa-miR-26a	CLIP-seq
MIRT1983702	hsa-miR-26b	CLIP-seq
MIRT2522269	hsa-miR-301a	CLIP-seq
MIRT2522270	hsa-miR-301b	CLIP-seq
MIRT2448743	hsa-miR-3116	CLIP-seq
MIRT2448744	hsa-miR-3149	CLIP-seq
MIRT2522271	hsa-miR-3155	CLIP-seq
MIRT2522272	hsa-miR-3155b	CLIP-seq
MIRT2522273	hsa-miR-3186-5p	CLIP-seq
MIRT2218987	hsa-miR-3199	CLIP-seq
MIRT2522274	hsa-miR-3663-5p	CLIP-seq
MIRT2522275	hsa-miR-3664-3p	CLIP-seq
MIRT2522276	hsa-miR-3666	CLIP-seq
MIRT2522277	hsa-miR-3934	CLIP-seq
MIRT2448745	hsa-miR-411	CLIP-seq
MIRT1983703	hsa-miR-4279	CLIP-seq
MIRT2522278	hsa-miR-4284	CLIP-seq
MIRT2522279	hsa-miR-4295	CLIP-seq
MIRT1983704	hsa-miR-4324	CLIP-seq
MIRT2522280	hsa-miR-4438	CLIP-seq
MIRT2522281	hsa-miR-4454	CLIP-seq
MIRT1983705	hsa-miR-4465	CLIP-seq
MIRT2522282	hsa-miR-4474-3p	CLIP-seq
MIRT2522283	hsa-miR-4534	CLIP-seq
MIRT2522284	hsa-miR-454	CLIP-seq
MIRT2522285	hsa-miR-4654	CLIP-seq
MIRT1983709	hsa-miR-4683	CLIP-seq
MIRT1983710	hsa-miR-4695-3p	CLIP-seq
MIRT2448746	hsa-miR-4715-3p	CLIP-seq
MIRT2522286	hsa-miR-4716-5p	CLIP-seq
MIRT1983711	hsa-miR-4722-3p	CLIP-seq
MIRT2522287	hsa-miR-4722-5p	CLIP-seq
MIRT2448747	hsa-miR-4735-5p	CLIP-seq
MIRT2522288	hsa-miR-4757-3p	CLIP-seq
MIRT2522289	hsa-miR-4763-5p	CLIP-seq
MIRT2522290	hsa-miR-4768-3p	CLIP-seq
MIRT2522291	hsa-miR-4769-5p	CLIP-seq
MIRT2522292	hsa-miR-4772-3p	CLIP-seq
MIRT2448748	hsa-miR-4775	CLIP-seq
MIRT2522293	hsa-miR-4781-3p	CLIP-seq
MIRT2448749	hsa-miR-4794	CLIP-seq
MIRT2522294	hsa-miR-4796-3p	CLIP-seq
MIRT2522295	hsa-miR-484	CLIP-seq
MIRT2522296	hsa-miR-5095	CLIP-seq
MIRT2522297	hsa-miR-515-5p	CLIP-seq
MIRT2522298	hsa-miR-541	CLIP-seq
MIRT1983713	hsa-miR-544b	CLIP-seq
MIRT2522299	hsa-miR-548t	CLIP-seq
MIRT2522300	hsa-miR-581	CLIP-seq
MIRT2448750	hsa-miR-590-3p	CLIP-seq
MIRT2522301	hsa-miR-654-5p	CLIP-seq
MIRT2448751	hsa-miR-661	CLIP-seq
MIRT2522302	hsa-miR-764	CLIP-seq
MIRT1983695	hsa-miR-1200	CLIP-seq
MIRT2522260	hsa-miR-122	CLIP-seq
MIRT2522261	hsa-miR-1227	CLIP-seq
MIRT2448742	hsa-miR-1254	CLIP-seq
MIRT2522262	hsa-miR-125a-3p	CLIP-seq
MIRT1983698	hsa-miR-1297	CLIP-seq
MIRT2522263	hsa-miR-130a	CLIP-seq
MIRT2522264	hsa-miR-130b	CLIP-seq
MIRT2218986	hsa-miR-1343	CLIP-seq
MIRT2522265	hsa-miR-136	CLIP-seq
MIRT2522266	hsa-miR-139-3p	CLIP-seq
MIRT1983700	hsa-miR-1976	CLIP-seq
MIRT2522267	hsa-miR-2392	CLIP-seq
MIRT2522268	hsa-miR-24	CLIP-seq
MIRT1983701	hsa-miR-26a	CLIP-seq
MIRT1983702	hsa-miR-26b	CLIP-seq
MIRT2522269	hsa-miR-301a	CLIP-seq
MIRT2522270	hsa-miR-301b	CLIP-seq
MIRT2448743	hsa-miR-3116	CLIP-seq
MIRT2448744	hsa-miR-3149	CLIP-seq
MIRT2522271	hsa-miR-3155	CLIP-seq
MIRT2522272	hsa-miR-3155b	CLIP-seq
MIRT2522273	hsa-miR-3186-5p	CLIP-seq
MIRT2218987	hsa-miR-3199	CLIP-seq
MIRT2522274	hsa-miR-3663-5p	CLIP-seq
MIRT2522275	hsa-miR-3664-3p	CLIP-seq
MIRT2522276	hsa-miR-3666	CLIP-seq
MIRT2522277	hsa-miR-3934	CLIP-seq
MIRT2448745	hsa-miR-411	CLIP-seq
MIRT1983703	hsa-miR-4279	CLIP-seq
MIRT2522278	hsa-miR-4284	CLIP-seq
MIRT2522279	hsa-miR-4295	CLIP-seq
MIRT1983704	hsa-miR-4324	CLIP-seq
MIRT2522280	hsa-miR-4438	CLIP-seq
MIRT2522281	hsa-miR-4454	CLIP-seq
MIRT1983705	hsa-miR-4465	CLIP-seq
MIRT2522282	hsa-miR-4474-3p	CLIP-seq
MIRT2522283	hsa-miR-4534	CLIP-seq
MIRT2522284	hsa-miR-454	CLIP-seq
MIRT2522285	hsa-miR-4654	CLIP-seq
MIRT1983710	hsa-miR-4695-3p	CLIP-seq
MIRT2448746	hsa-miR-4715-3p	CLIP-seq
MIRT2522286	hsa-miR-4716-5p	CLIP-seq
MIRT1983711	hsa-miR-4722-3p	CLIP-seq
MIRT2522287	hsa-miR-4722-5p	CLIP-seq
MIRT2448747	hsa-miR-4735-5p	CLIP-seq
MIRT2522288	hsa-miR-4757-3p	CLIP-seq
MIRT2522289	hsa-miR-4763-5p	CLIP-seq
MIRT2522290	hsa-miR-4768-3p	CLIP-seq
MIRT2522291	hsa-miR-4769-5p	CLIP-seq
MIRT2522292	hsa-miR-4772-3p	CLIP-seq
MIRT2448748	hsa-miR-4775	CLIP-seq
MIRT2522293	hsa-miR-4781-3p	CLIP-seq
MIRT2448749	hsa-miR-4794	CLIP-seq
MIRT2522294	hsa-miR-4796-3p	CLIP-seq
MIRT2522295	hsa-miR-484	CLIP-seq
MIRT2522296	hsa-miR-5095	CLIP-seq
MIRT2522297	hsa-miR-515-5p	CLIP-seq
MIRT2522298	hsa-miR-541	CLIP-seq
MIRT1983713	hsa-miR-544b	CLIP-seq
MIRT2522299	hsa-miR-548t	CLIP-seq
MIRT2522300	hsa-miR-581	CLIP-seq
MIRT2448750	hsa-miR-590-3p	CLIP-seq
MIRT2522301	hsa-miR-654-5p	CLIP-seq
MIRT2448751	hsa-miR-661	CLIP-seq
MIRT2522302	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IBA
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	25849773
GO:0003743	Function	Translation initiation factor activity	IDA	17581632
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	14688252, 17094969, 18599441, 18624398, 18628297, 24965446, 25959826, 28514442, 32814053, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	IEA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IBA
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA

Other IDs

• MIM: 603911
• HGNC: 3272
• e!Ensembl: ENSG00000084623

Protein

• UniProt ID: Q13347
• Protein name: Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (TGF-beta receptor-interacting protein 1) (TRIP-1) (eIF-3-beta) (eIF3 p36)
• Protein function: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
• PDB: 6YBT, 6ZMW, 6ZON, 6ZP4, 6ZVJ, 7A09, 8OZ0, 8PJ1, 8PJ2, 8PJ3, 8PJ4, 8PJ5, 8PJ6, 8XXN, 9BLN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	3 → 37	WD domain, G-beta repeat	Repeat
  PF00400	WD40	42 → 80	WD domain, G-beta repeat	Repeat
  PF00400	WD40	275 → 312	WD domain, G-beta repeat	Repeat

• Sequence:

  MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
  DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
  FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
  LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
  YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
  SSGGEDGYVRIHYFDPQYFEFEFEA

• Sequence length: 325

Pathways

Reactome:

L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25147179		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33754896	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24056964	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16929481		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32100822	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25147179		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	24056964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	24056964	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24056964	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31778600	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31171919		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25147179, 25609201		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36193788	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25147179		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31765158		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	24056964		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31765158, 9169003		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25147179, 28193911, 31765158		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9169003		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	9169003		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31778600	Stimulate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	29173589		★☆☆☆☆ Found in Text Mining only