Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8667
Gene name	Eukaryotic translation initiation factor 3 subunit H
Gene symbol	EIF3H
Synonyms (NCBI Gene)	EIF3S3eIF3-gammaeIF3-p40
Chromosome	8
Chromosome location	8q23.3-q24.11

258

Show/Hide all (258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031946	hsa-miR-16-5p	Proteomics	18668040
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539713	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539706	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT539705	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	27292025
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	27292025
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	27292025
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	27292025
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	27292025
MIRT539720	hsa-miR-3609	PAR-CLIP	27292025
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	27292025
MIRT539699	hsa-miR-3672	PAR-CLIP	27292025
MIRT539704	hsa-miR-4522	PAR-CLIP	27292025
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	27292025
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT539716	hsa-miR-520h	PAR-CLIP	27292025
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	27292025
MIRT539709	hsa-miR-612	PAR-CLIP	27292025
MIRT539702	hsa-miR-661	PAR-CLIP	27292025
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT539708	hsa-miR-6860	PAR-CLIP	27292025
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	27292025
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	27292025
MIRT539703	hsa-miR-873-3p	PAR-CLIP	27292025
MIRT539713	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539713	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539706	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT539705	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957578	hsa-miR-1208	CLIP-seq
MIRT957579	hsa-miR-1299	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957582	hsa-miR-135a	CLIP-seq
MIRT957583	hsa-miR-135b	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957591	hsa-miR-3651	CLIP-seq
MIRT957592	hsa-miR-4261	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT957595	hsa-miR-4662a-5p	CLIP-seq
MIRT957596	hsa-miR-4782-5p	CLIP-seq
MIRT957597	hsa-miR-516b	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957600	hsa-miR-875-3p	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957591	hsa-miR-3651	CLIP-seq
MIRT2218985	hsa-miR-425	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT957595	hsa-miR-4662a-5p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT2428452	hsa-miR-4795-3p	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957579	hsa-miR-1299	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957592	hsa-miR-4261	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957596	hsa-miR-4782-5p	CLIP-seq
MIRT957597	hsa-miR-516b	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957600	hsa-miR-875-3p	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957579	hsa-miR-1299	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957592	hsa-miR-4261	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957596	hsa-miR-4782-5p	CLIP-seq
MIRT957597	hsa-miR-516b	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957600	hsa-miR-875-3p	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	12812986, 16189514, 17043677, 18599441, 18628297, 19060904, 19615732, 19748344, 22190034, 23623729, 26100019, 28514442, 30021884, 31413325, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	IEA
GO:0006446	Process	Regulation of translational initiation	TAS	9341143
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IBA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IBA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	32269044
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IDA	32269044
GO:0140492	Function	Metal-dependent deubiquitinase activity	IEA

MIM	HGNC	e!Ensembl
603912	3273	ENSG00000147677

O15372

Protein name

Eukaryotic translation initiation factor 3 subunit H (eIF3h) (Eukaryotic translation initiation factor 3 subunit 3) (eIF-3-gamma) (eIF3 p40 subunit)

Protein function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40

PDB

3J8B , 3J8C , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	34 → 146	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family

Sequence

MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGT
EVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWY
QSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEK
DFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLG
KNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEED
LSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	Measles		L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARREST	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLON CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34367470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	14997205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24927736		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10362802, 24927736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14997205	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37559097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11733359, 14997205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37559097, 40069645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	10362802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18372905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20862326, 30022709, 31246501		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18372905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20862326, 22367214, 32170005, 37527660	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	14578863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31817792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31817792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	37527660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	22633631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14578863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	14578863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11733359	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10825005, 24927736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31817792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10825005, 11733359, 12000731, 14997205, 16652384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	14997205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30060823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10825005, 11733359, 16652384, 30022709, 30060823, 30232453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10362802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11733359, 14578863, 29805516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19204574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29805516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34332578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10825005, 11733359, 12000731, 14997205, 16652384		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10362802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11733359, 14997205	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14997205		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	14997205		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30060823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34802261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF3H (eukaryotic translation initiation factor 3 subunit H)