EIF3D (eukaryotic translation initiation factor 3 subunit D)

Gene

• Entrez ID: 8664
• Gene name: Eukaryotic translation initiation factor 3 subunit D
• Gene symbol: EIF3D
• Synonyms (NCBI Gene): EIF3S7, eIF3-p66, eIF3-zeta
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissocia

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052211	hsa-let-7b-5p	CLASH	23622248
MIRT043981	hsa-miR-378a-5p	CLASH	23622248
MIRT040086	hsa-miR-615-3p	CLASH	23622248
MIRT038210	hsa-miR-342-5p	CLASH	23622248
MIRT037879	hsa-miR-455-3p	CLASH	23622248
MIRT1983686	hsa-miR-4436b-5p	CLIP-seq
MIRT2218960	hsa-miR-3190	CLIP-seq
MIRT2218961	hsa-miR-3202	CLIP-seq
MIRT2218962	hsa-miR-3919	CLIP-seq
MIRT2218963	hsa-miR-4267	CLIP-seq
MIRT1983686	hsa-miR-4436b-5p	CLIP-seq
MIRT2218964	hsa-miR-4474-5p	CLIP-seq
MIRT2218965	hsa-miR-4533	CLIP-seq
MIRT2218966	hsa-miR-4655-3p	CLIP-seq
MIRT2218967	hsa-miR-4686	CLIP-seq
MIRT2218968	hsa-miR-4756-3p	CLIP-seq
MIRT2218969	hsa-miR-499-3p	CLIP-seq
MIRT2218970	hsa-miR-499a-3p	CLIP-seq
MIRT2218971	hsa-miR-508-5p	CLIP-seq
MIRT2218972	hsa-miR-766	CLIP-seq
MIRT2218963	hsa-miR-4267	CLIP-seq
MIRT2218969	hsa-miR-499-3p	CLIP-seq
MIRT2218970	hsa-miR-499a-3p	CLIP-seq
MIRT2218971	hsa-miR-508-5p	CLIP-seq
MIRT2218972	hsa-miR-766	CLIP-seq
MIRT2218963	hsa-miR-4267	CLIP-seq
MIRT2218969	hsa-miR-499-3p	CLIP-seq
MIRT2218970	hsa-miR-499a-3p	CLIP-seq
MIRT2218971	hsa-miR-508-5p	CLIP-seq
MIRT2218972	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IDA	24092755
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0002191	Process	Cap-dependent translational initiation	IDA	27462815
GO:0002191	Process	Cap-dependent translational initiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	25849773
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773, 27462815
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11369516, 18599441, 18628297, 20890303, 22190034, 23623729, 25416956, 28514442, 32296183, 33961781, 34819669, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773, 27462815
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632, 24092755
GO:0006413	Process	Translational initiation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0045202	Component	Synapse	IEA
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	9573242
GO:0075525	Process	Viral translational termination-reinitiation	IDA	21347434
GO:0098808	Function	MRNA cap binding	IDA	27462815
GO:0098808	Function	MRNA cap binding	IEA

Other IDs

• MIM: 603915
• HGNC: 3278
• e!Ensembl: ENSG00000100353

Protein

• UniProt ID: O15371
• Protein name: Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66)
• Protein function: mRNA cap-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, a complex required for several steps in the initiation of protein synthesis of a specialized repertoire of mRNAs (PubMed:27462815). The eIF-3 complex a
• PDB: 6YBD, 6YBS, 6ZMW, 6ZON, 6ZP4, 6ZVJ, 7A09, 7QP6, 7QP7, 8OZ0, 8PJ1, 8PJ2, 8PJ3, 8PJ4, 8PJ5, 8PJ6, 8PPL, 8RG0, 8XXN, 9BLN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05091	eIF-3_zeta	4 → 521	Eukaryotic translation initiation factor 3 subunit 7 (eIF-3)	Family

• Sequence:

  MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYS
  SQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQ
  ILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLM
  KMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAK
  TQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQ
  DEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRY
  RRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV
  IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQI
  NLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEE
  EEEEEEET

• Sequence length: 548

Pathways

Reactome:

L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29050215		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26617750		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26617750	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31280863	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31280863	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29050215		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25370813, 30096129		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25370813		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25370813	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27035563, 31669222		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28594409		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25682860		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31118081		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28801778		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28801778		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31280863		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26617750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28594409		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26036682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29123423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29050215		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28594409, 31280863		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25370813, 30096129		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25322666		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21052085		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21052085	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27035563, 28594409, 29050215, 31669222		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26008152, 31053950		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26036682		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33273988	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27035563, 31669222		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38535990	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29123423		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35104170, 36264610	Associate	★☆☆☆☆ Found in Text Mining only