Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8662
Gene name	Eukaryotic translation initiation factor 3 subunit B
Gene symbol	EIF3B
Synonyms (NCBI Gene)	EIF3-ETAEIF3-P110EIF3-P116EIF3S9PRT1
Chromosome	7
Chromosome location	7p22.3

176

Show/Hide all (176)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022932	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT049064	hsa-miR-92a-3p	CLASH	23622248
MIRT046746	hsa-miR-222-3p	CLASH	23622248
MIRT043600	hsa-miR-151a-3p	CLASH	23622248
MIRT042887	hsa-miR-324-3p	CLASH	23622248
MIRT042887	hsa-miR-324-3p	CLASH	23622248
MIRT042468	hsa-miR-423-3p	CLASH	23622248
MIRT042468	hsa-miR-423-3p	CLASH	23622248
MIRT039779	hsa-miR-615-3p	CLASH	23622248
MIRT039779	hsa-miR-615-3p	CLASH	23622248
MIRT036964	hsa-miR-877-3p	CLASH	23622248
MIRT957487	hsa-miR-1264	CLIP-seq
MIRT957488	hsa-miR-18a	CLIP-seq
MIRT957489	hsa-miR-18b	CLIP-seq
MIRT957490	hsa-miR-193a-5p	CLIP-seq
MIRT957491	hsa-miR-3145-5p	CLIP-seq
MIRT957492	hsa-miR-3177-3p	CLIP-seq
MIRT957493	hsa-miR-3178	CLIP-seq
MIRT957494	hsa-miR-338-3p	CLIP-seq
MIRT957495	hsa-miR-3622b-5p	CLIP-seq
MIRT957496	hsa-miR-3910	CLIP-seq
MIRT957497	hsa-miR-4261	CLIP-seq
MIRT957498	hsa-miR-4290	CLIP-seq
MIRT957499	hsa-miR-4434	CLIP-seq
MIRT957500	hsa-miR-4447	CLIP-seq
MIRT957501	hsa-miR-4467	CLIP-seq
MIRT957502	hsa-miR-4472	CLIP-seq
MIRT957503	hsa-miR-4486	CLIP-seq
MIRT957504	hsa-miR-4497	CLIP-seq
MIRT957505	hsa-miR-4516	CLIP-seq
MIRT957506	hsa-miR-4530	CLIP-seq
MIRT957507	hsa-miR-4632	CLIP-seq
MIRT957508	hsa-miR-4707-3p	CLIP-seq
MIRT957509	hsa-miR-4714-3p	CLIP-seq
MIRT957510	hsa-miR-4722-5p	CLIP-seq
MIRT957511	hsa-miR-4735-3p	CLIP-seq
MIRT957512	hsa-miR-4768-3p	CLIP-seq
MIRT957513	hsa-miR-4783-3p	CLIP-seq
MIRT957514	hsa-miR-494	CLIP-seq
MIRT957515	hsa-miR-499-3p	CLIP-seq
MIRT957516	hsa-miR-499a-3p	CLIP-seq
MIRT957517	hsa-miR-624	CLIP-seq
MIRT957518	hsa-miR-658	CLIP-seq
MIRT957487	hsa-miR-1264	CLIP-seq
MIRT1983672	hsa-miR-128	CLIP-seq
MIRT957488	hsa-miR-18a	CLIP-seq
MIRT957489	hsa-miR-18b	CLIP-seq
MIRT1983673	hsa-miR-3140-3p	CLIP-seq
MIRT1983674	hsa-miR-3158-5p	CLIP-seq
MIRT957493	hsa-miR-3178	CLIP-seq
MIRT1983675	hsa-miR-3190	CLIP-seq
MIRT1983676	hsa-miR-361-3p	CLIP-seq
MIRT1983677	hsa-miR-3656	CLIP-seq
MIRT957497	hsa-miR-4261	CLIP-seq
MIRT1983678	hsa-miR-4286	CLIP-seq
MIRT1983679	hsa-miR-4418	CLIP-seq
MIRT957499	hsa-miR-4434	CLIP-seq
MIRT957503	hsa-miR-4486	CLIP-seq
MIRT957505	hsa-miR-4516	CLIP-seq
MIRT957507	hsa-miR-4632	CLIP-seq
MIRT957509	hsa-miR-4714-3p	CLIP-seq
MIRT1983680	hsa-miR-4716-5p	CLIP-seq
MIRT957510	hsa-miR-4722-5p	CLIP-seq
MIRT957511	hsa-miR-4735-3p	CLIP-seq
MIRT957512	hsa-miR-4768-3p	CLIP-seq
MIRT957514	hsa-miR-494	CLIP-seq
MIRT957515	hsa-miR-499-3p	CLIP-seq
MIRT957516	hsa-miR-499a-3p	CLIP-seq
MIRT1983681	hsa-miR-509-3-5p	CLIP-seq
MIRT1983682	hsa-miR-509-5p	CLIP-seq
MIRT1983683	hsa-miR-587	CLIP-seq
MIRT1983684	hsa-miR-605	CLIP-seq
MIRT957518	hsa-miR-658	CLIP-seq
MIRT1983685	hsa-miR-671-5p	CLIP-seq
MIRT2218943	hsa-miR-1321	CLIP-seq
MIRT957488	hsa-miR-18a	CLIP-seq
MIRT957489	hsa-miR-18b	CLIP-seq
MIRT2218944	hsa-miR-191	CLIP-seq
MIRT2218945	hsa-miR-205	CLIP-seq
MIRT957491	hsa-miR-3145-5p	CLIP-seq
MIRT957492	hsa-miR-3177-3p	CLIP-seq
MIRT2218946	hsa-miR-3177-5p	CLIP-seq
MIRT957493	hsa-miR-3178	CLIP-seq
MIRT1983675	hsa-miR-3190	CLIP-seq
MIRT957494	hsa-miR-338-3p	CLIP-seq
MIRT1983676	hsa-miR-361-3p	CLIP-seq
MIRT1983677	hsa-miR-3656	CLIP-seq
MIRT957497	hsa-miR-4261	CLIP-seq
MIRT2218947	hsa-miR-4269	CLIP-seq
MIRT2218948	hsa-miR-4270	CLIP-seq
MIRT1983678	hsa-miR-4286	CLIP-seq
MIRT1983679	hsa-miR-4418	CLIP-seq
MIRT957499	hsa-miR-4434	CLIP-seq
MIRT2218949	hsa-miR-4438	CLIP-seq
MIRT2218950	hsa-miR-4441	CLIP-seq
MIRT957500	hsa-miR-4447	CLIP-seq
MIRT957502	hsa-miR-4472	CLIP-seq
MIRT957503	hsa-miR-4486	CLIP-seq
MIRT957505	hsa-miR-4516	CLIP-seq
MIRT957506	hsa-miR-4530	CLIP-seq
MIRT957507	hsa-miR-4632	CLIP-seq
MIRT2218951	hsa-miR-4638-5p	CLIP-seq
MIRT2218952	hsa-miR-4645-5p	CLIP-seq
MIRT2218953	hsa-miR-4673	CLIP-seq
MIRT2218954	hsa-miR-4704-3p	CLIP-seq
MIRT957508	hsa-miR-4707-3p	CLIP-seq
MIRT957509	hsa-miR-4714-3p	CLIP-seq
MIRT1983680	hsa-miR-4716-5p	CLIP-seq
MIRT957510	hsa-miR-4722-5p	CLIP-seq
MIRT957511	hsa-miR-4735-3p	CLIP-seq
MIRT2218955	hsa-miR-4739	CLIP-seq
MIRT2218956	hsa-miR-4756-5p	CLIP-seq
MIRT957512	hsa-miR-4768-3p	CLIP-seq
MIRT2218957	hsa-miR-4795-5p	CLIP-seq
MIRT957514	hsa-miR-494	CLIP-seq
MIRT957515	hsa-miR-499-3p	CLIP-seq
MIRT957516	hsa-miR-499a-3p	CLIP-seq
MIRT1983681	hsa-miR-509-3-5p	CLIP-seq
MIRT2218958	hsa-miR-5095	CLIP-seq
MIRT1983682	hsa-miR-509-5p	CLIP-seq
MIRT1983683	hsa-miR-587	CLIP-seq
MIRT1983684	hsa-miR-605	CLIP-seq
MIRT957517	hsa-miR-624	CLIP-seq
MIRT957518	hsa-miR-658	CLIP-seq
MIRT1983685	hsa-miR-671-5p	CLIP-seq
MIRT2218959	hsa-miR-95	CLIP-seq
MIRT2448735	hsa-miR-1289	CLIP-seq
MIRT2448736	hsa-miR-214	CLIP-seq
MIRT2448737	hsa-miR-2277-5p	CLIP-seq
MIRT2448738	hsa-miR-3619-5p	CLIP-seq
MIRT2448739	hsa-miR-3937	CLIP-seq
MIRT2448740	hsa-miR-4690-5p	CLIP-seq
MIRT2448741	hsa-miR-761	CLIP-seq
MIRT957487	hsa-miR-1264	CLIP-seq
MIRT2448735	hsa-miR-1289	CLIP-seq
MIRT957488	hsa-miR-18a	CLIP-seq
MIRT957489	hsa-miR-18b	CLIP-seq
MIRT2522258	hsa-miR-3137	CLIP-seq
MIRT957493	hsa-miR-3178	CLIP-seq
MIRT957497	hsa-miR-4261	CLIP-seq
MIRT957499	hsa-miR-4434	CLIP-seq
MIRT957503	hsa-miR-4486	CLIP-seq
MIRT957505	hsa-miR-4516	CLIP-seq
MIRT957507	hsa-miR-4632	CLIP-seq
MIRT957510	hsa-miR-4722-5p	CLIP-seq
MIRT957511	hsa-miR-4735-3p	CLIP-seq
MIRT957512	hsa-miR-4768-3p	CLIP-seq
MIRT2522259	hsa-miR-486-5p	CLIP-seq
MIRT957514	hsa-miR-494	CLIP-seq
MIRT957515	hsa-miR-499-3p	CLIP-seq
MIRT957516	hsa-miR-499a-3p	CLIP-seq
MIRT957487	hsa-miR-1264	CLIP-seq
MIRT2448735	hsa-miR-1289	CLIP-seq
MIRT957488	hsa-miR-18a	CLIP-seq
MIRT957489	hsa-miR-18b	CLIP-seq
MIRT2448736	hsa-miR-214	CLIP-seq
MIRT2448737	hsa-miR-2277-5p	CLIP-seq
MIRT2522258	hsa-miR-3137	CLIP-seq
MIRT957491	hsa-miR-3145-5p	CLIP-seq
MIRT957493	hsa-miR-3178	CLIP-seq
MIRT2448738	hsa-miR-3619-5p	CLIP-seq
MIRT2448739	hsa-miR-3937	CLIP-seq
MIRT957497	hsa-miR-4261	CLIP-seq
MIRT957499	hsa-miR-4434	CLIP-seq
MIRT957503	hsa-miR-4486	CLIP-seq
MIRT957505	hsa-miR-4516	CLIP-seq
MIRT957507	hsa-miR-4632	CLIP-seq
MIRT2448740	hsa-miR-4690-5p	CLIP-seq
MIRT957510	hsa-miR-4722-5p	CLIP-seq
MIRT957511	hsa-miR-4735-3p	CLIP-seq
MIRT957512	hsa-miR-4768-3p	CLIP-seq
MIRT2522259	hsa-miR-486-5p	CLIP-seq
MIRT957514	hsa-miR-494	CLIP-seq
MIRT957515	hsa-miR-499-3p	CLIP-seq
MIRT957516	hsa-miR-499a-3p	CLIP-seq
MIRT2448741	hsa-miR-761	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IDA	25849773, 27462815
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IDA	8995410
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11169732, 14688252, 15567442, 18423201, 18599441, 18628297, 19245811, 19615732, 21986499, 23023399, 24396066, 24423872, 30021884, 33961781, 34819669, 35271311, 39251607
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	8995410, 17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	8995410, 17581632
GO:0006413	Process	Translational initiation	IEA
GO:0006446	Process	Regulation of translational initiation	IDA	8995410
GO:0010494	Component	Cytoplasmic stress granule	IDA	17984221
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0031369	Function	Translation initiation factor binding	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0045202	Component	Synapse	IEA
GO:0060090	Function	Molecular adaptor activity	TAS	17322308
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	9573242
GO:0075525	Process	Viral translational termination-reinitiation	IDA	21347434

MIM	HGNC	e!Ensembl
603917	3280	ENSG00000106263

P55884

Protein name

Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (Prt1 homolog) (hPrt1) (eIF-3-eta) (eIF3 p110) (eIF3 p116)

Protein function

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815, PubMed:9388245). The eIF-3 co

PDB

2KRB , 2NLW , 5K1H , 6YBT , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	202 → 260	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF08662	eIF2A	507 → 702	Eukaryotic translation initiation factor eIF2A	Family

Sequence

MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEA
GPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSR
AQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE

Sequence length

814

Interactions

View interactions

	Reactome
			L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	26512942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23575475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35040374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30198870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39276983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23575475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32419232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22734884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22734884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28928896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27270324	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30556540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22234522, 28360085, 31778600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22234522, 28360085, 31778600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	37020555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28715695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27270324, 30198870, 31322539	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32419232, 33277855, 36050601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23575475, 28360085, 31778600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31686906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23575475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23575475, 30416377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22734884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35273605, 36050601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31778600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16308470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23575475, 30198870, 31322539, 31686906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30198870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28360085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30551537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23575475, 28360085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24858725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31481019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31686906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31322539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF3B (eukaryotic translation initiation factor 3 subunit B)