Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8661
Gene name	Eukaryotic translation initiation factor 3 subunit A
Gene symbol	EIF3A
Synonyms (NCBI Gene)	EIF3EIF3S10P167TIF32eIF3-p170eIF3-thetap180p185
Chromosome	10
Chromosome location	10q26.11

183

Show/Hide all (183)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020771	hsa-miR-155-5p	Proteomics	18668040
MIRT031705	hsa-miR-16-5p	Proteomics	18668040
MIRT051776	hsa-let-7c-5p	CLASH	23622248
MIRT042324	hsa-miR-484	CLASH	23622248
MIRT040974	hsa-miR-18a-3p	CLASH	23622248
MIRT040734	hsa-miR-92b-3p	CLASH	23622248
MIRT737296	hsa-miR-875-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	33000235
MIRT957446	hsa-miR-105	CLIP-seq
MIRT957447	hsa-miR-1280	CLIP-seq
MIRT957448	hsa-miR-1297	CLIP-seq
MIRT957449	hsa-miR-182	CLIP-seq
MIRT957450	hsa-miR-186	CLIP-seq
MIRT957451	hsa-miR-2054	CLIP-seq
MIRT957452	hsa-miR-23a	CLIP-seq
MIRT957453	hsa-miR-23b	CLIP-seq
MIRT957454	hsa-miR-23c	CLIP-seq
MIRT957455	hsa-miR-26a	CLIP-seq
MIRT957456	hsa-miR-26b	CLIP-seq
MIRT957457	hsa-miR-3133	CLIP-seq
MIRT957458	hsa-miR-3148	CLIP-seq
MIRT957459	hsa-miR-3179	CLIP-seq
MIRT957460	hsa-miR-3655	CLIP-seq
MIRT957461	hsa-miR-3680	CLIP-seq
MIRT957462	hsa-miR-3682-5p	CLIP-seq
MIRT957463	hsa-miR-3688-3p	CLIP-seq
MIRT957464	hsa-miR-409-3p	CLIP-seq
MIRT957465	hsa-miR-4263	CLIP-seq
MIRT957466	hsa-miR-4282	CLIP-seq
MIRT957467	hsa-miR-4465	CLIP-seq
MIRT957468	hsa-miR-4509	CLIP-seq
MIRT957469	hsa-miR-4668-3p	CLIP-seq
MIRT957470	hsa-miR-4744	CLIP-seq
MIRT957471	hsa-miR-4768-5p	CLIP-seq
MIRT957472	hsa-miR-4798-3p	CLIP-seq
MIRT957473	hsa-miR-4799-5p	CLIP-seq
MIRT957474	hsa-miR-512-5p	CLIP-seq
MIRT957475	hsa-miR-513a-3p	CLIP-seq
MIRT957476	hsa-miR-513c	CLIP-seq
MIRT957477	hsa-miR-514b-5p	CLIP-seq
MIRT957478	hsa-miR-548ae	CLIP-seq
MIRT957479	hsa-miR-548aj	CLIP-seq
MIRT957480	hsa-miR-548am	CLIP-seq
MIRT957481	hsa-miR-548x	CLIP-seq
MIRT957482	hsa-miR-576-5p	CLIP-seq
MIRT957483	hsa-miR-605	CLIP-seq
MIRT957484	hsa-miR-616	CLIP-seq
MIRT957485	hsa-miR-885-5p	CLIP-seq
MIRT957486	hsa-miR-942	CLIP-seq
MIRT957450	hsa-miR-186	CLIP-seq
MIRT1983659	hsa-miR-1914	CLIP-seq
MIRT957457	hsa-miR-3133	CLIP-seq
MIRT1983660	hsa-miR-3201	CLIP-seq
MIRT1983661	hsa-miR-3622b-5p	CLIP-seq
MIRT957461	hsa-miR-3680	CLIP-seq
MIRT1983662	hsa-miR-3691-5p	CLIP-seq
MIRT957466	hsa-miR-4282	CLIP-seq
MIRT1983663	hsa-miR-4694-5p	CLIP-seq
MIRT1983664	hsa-miR-4752	CLIP-seq
MIRT1983665	hsa-miR-4786-5p	CLIP-seq
MIRT1983666	hsa-miR-4791	CLIP-seq
MIRT957472	hsa-miR-4798-3p	CLIP-seq
MIRT1983667	hsa-miR-505	CLIP-seq
MIRT1983668	hsa-miR-548m	CLIP-seq
MIRT1983669	hsa-miR-577	CLIP-seq
MIRT1983670	hsa-miR-769-5p	CLIP-seq
MIRT1983671	hsa-miR-888	CLIP-seq
MIRT957449	hsa-miR-182	CLIP-seq
MIRT957450	hsa-miR-186	CLIP-seq
MIRT2218935	hsa-miR-302f	CLIP-seq
MIRT2218936	hsa-miR-3180-5p	CLIP-seq
MIRT957460	hsa-miR-3655	CLIP-seq
MIRT2218937	hsa-miR-377	CLIP-seq
MIRT2218938	hsa-miR-4320	CLIP-seq
MIRT2218939	hsa-miR-452	CLIP-seq
MIRT2218940	hsa-miR-4676-3p	CLIP-seq
MIRT1983667	hsa-miR-505	CLIP-seq
MIRT957474	hsa-miR-512-5p	CLIP-seq
MIRT2218941	hsa-miR-520a-5p	CLIP-seq
MIRT2218942	hsa-miR-525-5p	CLIP-seq
MIRT957478	hsa-miR-548ae	CLIP-seq
MIRT957479	hsa-miR-548aj	CLIP-seq
MIRT957480	hsa-miR-548am	CLIP-seq
MIRT957481	hsa-miR-548x	CLIP-seq
MIRT957484	hsa-miR-616	CLIP-seq
MIRT957460	hsa-miR-3655	CLIP-seq
MIRT957484	hsa-miR-616	CLIP-seq
MIRT2522236	hsa-miR-127-5p	CLIP-seq
MIRT957447	hsa-miR-1280	CLIP-seq
MIRT957448	hsa-miR-1297	CLIP-seq
MIRT957450	hsa-miR-186	CLIP-seq
MIRT957451	hsa-miR-2054	CLIP-seq
MIRT2522237	hsa-miR-208a	CLIP-seq
MIRT2522238	hsa-miR-208b	CLIP-seq
MIRT957455	hsa-miR-26a	CLIP-seq
MIRT957456	hsa-miR-26b	CLIP-seq
MIRT2218935	hsa-miR-302f	CLIP-seq
MIRT957457	hsa-miR-3133	CLIP-seq
MIRT2522239	hsa-miR-3143	CLIP-seq
MIRT2522240	hsa-miR-3616-5p	CLIP-seq
MIRT2522241	hsa-miR-3617	CLIP-seq
MIRT2522242	hsa-miR-362-5p	CLIP-seq
MIRT2522243	hsa-miR-3647-5p	CLIP-seq
MIRT957460	hsa-miR-3655	CLIP-seq
MIRT2522244	hsa-miR-3658	CLIP-seq
MIRT957461	hsa-miR-3680	CLIP-seq
MIRT957462	hsa-miR-3682-5p	CLIP-seq
MIRT2522245	hsa-miR-369-3p	CLIP-seq
MIRT2522246	hsa-miR-374a	CLIP-seq
MIRT2522247	hsa-miR-374b	CLIP-seq
MIRT957464	hsa-miR-409-3p	CLIP-seq
MIRT957465	hsa-miR-4263	CLIP-seq
MIRT957466	hsa-miR-4282	CLIP-seq
MIRT957467	hsa-miR-4465	CLIP-seq
MIRT957468	hsa-miR-4509	CLIP-seq
MIRT957469	hsa-miR-4668-3p	CLIP-seq
MIRT957470	hsa-miR-4744	CLIP-seq
MIRT2522248	hsa-miR-4760-5p	CLIP-seq
MIRT957471	hsa-miR-4768-5p	CLIP-seq
MIRT1983665	hsa-miR-4786-5p	CLIP-seq
MIRT957472	hsa-miR-4798-3p	CLIP-seq
MIRT957473	hsa-miR-4799-5p	CLIP-seq
MIRT2522249	hsa-miR-4803	CLIP-seq
MIRT2522250	hsa-miR-494	CLIP-seq
MIRT2522251	hsa-miR-499-5p	CLIP-seq
MIRT2522252	hsa-miR-500a	CLIP-seq
MIRT2522253	hsa-miR-500b	CLIP-seq
MIRT2522254	hsa-miR-509-3p	CLIP-seq
MIRT957475	hsa-miR-513a-3p	CLIP-seq
MIRT957476	hsa-miR-513c	CLIP-seq
MIRT957477	hsa-miR-514b-5p	CLIP-seq
MIRT2522255	hsa-miR-563	CLIP-seq
MIRT2522256	hsa-miR-573	CLIP-seq
MIRT957482	hsa-miR-576-5p	CLIP-seq
MIRT957484	hsa-miR-616	CLIP-seq
MIRT2522257	hsa-miR-641	CLIP-seq
MIRT1983670	hsa-miR-769-5p	CLIP-seq
MIRT957486	hsa-miR-942	CLIP-seq
MIRT2522236	hsa-miR-127-5p	CLIP-seq
MIRT957447	hsa-miR-1280	CLIP-seq
MIRT957448	hsa-miR-1297	CLIP-seq
MIRT957450	hsa-miR-186	CLIP-seq
MIRT957451	hsa-miR-2054	CLIP-seq
MIRT2522237	hsa-miR-208a	CLIP-seq
MIRT2522238	hsa-miR-208b	CLIP-seq
MIRT957455	hsa-miR-26a	CLIP-seq
MIRT957456	hsa-miR-26b	CLIP-seq
MIRT2218935	hsa-miR-302f	CLIP-seq
MIRT957457	hsa-miR-3133	CLIP-seq
MIRT2522239	hsa-miR-3143	CLIP-seq
MIRT2522240	hsa-miR-3616-5p	CLIP-seq
MIRT2522242	hsa-miR-362-5p	CLIP-seq
MIRT2522243	hsa-miR-3647-5p	CLIP-seq
MIRT957460	hsa-miR-3655	CLIP-seq
MIRT2522244	hsa-miR-3658	CLIP-seq
MIRT957461	hsa-miR-3680	CLIP-seq
MIRT957462	hsa-miR-3682-5p	CLIP-seq
MIRT2522245	hsa-miR-369-3p	CLIP-seq
MIRT2522246	hsa-miR-374a	CLIP-seq
MIRT2522247	hsa-miR-374b	CLIP-seq
MIRT957464	hsa-miR-409-3p	CLIP-seq
MIRT957466	hsa-miR-4282	CLIP-seq
MIRT957467	hsa-miR-4465	CLIP-seq
MIRT957468	hsa-miR-4509	CLIP-seq
MIRT957469	hsa-miR-4668-3p	CLIP-seq
MIRT957470	hsa-miR-4744	CLIP-seq
MIRT2522248	hsa-miR-4760-5p	CLIP-seq
MIRT957471	hsa-miR-4768-5p	CLIP-seq
MIRT1983665	hsa-miR-4786-5p	CLIP-seq
MIRT957472	hsa-miR-4798-3p	CLIP-seq
MIRT2522249	hsa-miR-4803	CLIP-seq
MIRT2522250	hsa-miR-494	CLIP-seq
MIRT2522251	hsa-miR-499-5p	CLIP-seq
MIRT2522252	hsa-miR-500a	CLIP-seq
MIRT2522253	hsa-miR-500b	CLIP-seq
MIRT2522254	hsa-miR-509-3p	CLIP-seq
MIRT957475	hsa-miR-513a-3p	CLIP-seq
MIRT957476	hsa-miR-513c	CLIP-seq
MIRT957477	hsa-miR-514b-5p	CLIP-seq
MIRT2522255	hsa-miR-563	CLIP-seq
MIRT2522256	hsa-miR-573	CLIP-seq
MIRT957484	hsa-miR-616	CLIP-seq
MIRT1983670	hsa-miR-769-5p	CLIP-seq
MIRT957486	hsa-miR-942	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IBA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IDA	17581632
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0002188	Process	Translation reinitiation	IBA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	25849773, 27462815
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005198	Function	Structural molecule activity	NAS	9150439
GO:0005515	Function	Protein binding	IPI	11169732, 14688252, 17468741, 18423202, 18599441, 18628297, 19245811, 21124883, 22190034, 23623729, 25416956, 28514442, 33961781, 35271311
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	9150439
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0005874	Component	Microtubule	IEA
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0043226	Component	Organelle	IEA
GO:0043614	Component	Multi-eIF complex	IBA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071540	Component	Eukaryotic translation initiation factor 3 complex, eIF3e	IBA
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IBA
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	9573242, 23766293, 24357634
GO:0075525	Process	Viral translational termination-reinitiation	IDA	21347434

MIM	HGNC	e!Ensembl
602039	3271	ENSG00000107581

Q14152

Protein name

Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185)

Protein function

RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773). The eIF-3 complex associates with the 40S rib

PDB

3J8B , 3J8C , 6YBD , 6YBT , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01399	PCI	365 → 495	PCI domain	Domain

Sequence

MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRR
GMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPR
RGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPW
RNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEE
REWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWR
DSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDR
VEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTV
RR

Sequence length

1382

Interactions

View interactions

	Reactome
			L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
KERATOCONUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (77)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24961450, 2747638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11773973, 1350198, 1962774, 2400999, 2571966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	8893583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	2571966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29505099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	8605096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25898924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	9473236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	7914508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11097092, 11400121, 12160331, 1352298, 19377877, 1968437, 1972345, 21607584, 7904177, 7910395, 8095050, 8660324, 8808711, 9067293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10362802, 10569141, 10681513, 12699058, 19377877, 1968902, 21680730, 22002548, 27863425, 30573685, 35040374, 8095050, 8845823, 9846970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29093254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16929481, 1973590, 2571966, 9681912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12521301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25070653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1350198, 21610145, 23127338, 25732572, 31197975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26213845, 29581788, 7904177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28359406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29254159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24595351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29581788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fukuyama Type Congenital Muscular Dystrophy	Fukuyama Type Congenital Muscular Dystrophy	BEFREE	11738352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	12658908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	8605096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	8605096	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	8605096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31171919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	22804784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	37768948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10569141, 21680730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	31728542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36369953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37111057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25898924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	1347986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	15272411		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19007191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	2747638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10979973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	9473236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28715695, 31218114, 31363116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10534697, 15258328, 22804784, 25732572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12359054, 1968902, 28359406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11097092, 11400121, 11821047, 12160331, 1352298, 19377877, 1968437, 1972345, 21607584, 7904177, 8095050, 8660324, 8808711, 9067293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	1350198, 21610145, 23127338, 25732572, 31197975, 8893583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26213845, 7904177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10362802, 28676103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25070653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15221960, 16829125, 17918192, 18381585, 20056645, 20453879, 20838379, 20922269, 25070653, 25370813, 25450521, 27832536, 28322844, 28676103, 28854163 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	1968437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14632199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10648417, 2747638, 30340049, 9473236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	11738352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21625209, 23956056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10829039, 11961663, 1347986, 1350198, 15010883, 1672666, 16829125, 17170115, 1968437, 2400999, 25070653, 30340049, 31363116, 7904177, 8094034, 8095050, 9681912, 9852307 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29099306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	25898924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	1350198, 25732572, 28074905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	2188094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35295989	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26213845, 7904177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	7904177, 7908021, 9346940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26621506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26621506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	2747638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10362802, 28676103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25957199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	26464640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	26464640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	1350198, 15482324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29921696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	1352299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12439914, 27333287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28359406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	26213845		★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF3A (eukaryotic translation initiation factor 3 subunit A)