Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8655
Gene name	Dynein light chain LC8-type 1
Gene symbol	DYNLL1
Synonyms (NCBI Gene)	DLC1DLC8DNCL1DNCLC1LC8LC8aPINhdlc1
Chromosome	12
Chromosome location	12q24.31
Summary	Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of ac

149

Show/Hide all (149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049381	hsa-miR-92a-3p	CLASH	23622248
MIRT482726	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT482724	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT482725	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT482723	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT482722	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT482721	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT482720	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT482719	hsa-miR-6740-5p	PAR-CLIP	23592263
MIRT482718	hsa-miR-3616-5p	PAR-CLIP	23592263
MIRT482717	hsa-miR-573	PAR-CLIP	23592263
MIRT482716	hsa-miR-328-3p	PAR-CLIP	23592263
MIRT482715	hsa-miR-29b-2-5p	PAR-CLIP	23592263
MIRT482714	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT482726	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT482724	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT482725	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT482723	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT482722	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT482721	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT482720	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT482719	hsa-miR-6740-5p	PAR-CLIP	23592263
MIRT482718	hsa-miR-3616-5p	PAR-CLIP	23592263
MIRT482717	hsa-miR-573	PAR-CLIP	23592263
MIRT482716	hsa-miR-328-3p	PAR-CLIP	23592263
MIRT482715	hsa-miR-29b-2-5p	PAR-CLIP	23592263
MIRT482714	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT949121	hsa-miR-1193	CLIP-seq
MIRT949122	hsa-miR-1246	CLIP-seq
MIRT949123	hsa-miR-1290	CLIP-seq
MIRT949124	hsa-miR-147	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT949126	hsa-miR-204	CLIP-seq
MIRT949127	hsa-miR-211	CLIP-seq
MIRT949128	hsa-miR-3134	CLIP-seq
MIRT949129	hsa-miR-3167	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949132	hsa-miR-3647-3p	CLIP-seq
MIRT949133	hsa-miR-3650	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT949135	hsa-miR-3911	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949137	hsa-miR-4282	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949139	hsa-miR-4455	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT949142	hsa-miR-451b	CLIP-seq
MIRT949143	hsa-miR-4643	CLIP-seq
MIRT949144	hsa-miR-466	CLIP-seq
MIRT949145	hsa-miR-4708-3p	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT949147	hsa-miR-4755-5p	CLIP-seq
MIRT949148	hsa-miR-4766-3p	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT949150	hsa-miR-4789-3p	CLIP-seq
MIRT949151	hsa-miR-513a-3p	CLIP-seq
MIRT949152	hsa-miR-593	CLIP-seq
MIRT949153	hsa-miR-609	CLIP-seq
MIRT949154	hsa-miR-622	CLIP-seq
MIRT949155	hsa-miR-623	CLIP-seq
MIRT949156	hsa-miR-644	CLIP-seq
MIRT949157	hsa-miR-876-5p	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT949152	hsa-miR-593	CLIP-seq
MIRT949121	hsa-miR-1193	CLIP-seq
MIRT1981277	hsa-miR-146b-3p	CLIP-seq
MIRT949124	hsa-miR-147	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT1981278	hsa-miR-3065-5p	CLIP-seq
MIRT1981279	hsa-miR-3123	CLIP-seq
MIRT949128	hsa-miR-3134	CLIP-seq
MIRT1981280	hsa-miR-3173-5p	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949132	hsa-miR-3647-3p	CLIP-seq
MIRT1981281	hsa-miR-365	CLIP-seq
MIRT949133	hsa-miR-3650	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT1981282	hsa-miR-3688-5p	CLIP-seq
MIRT949135	hsa-miR-3911	CLIP-seq
MIRT1981283	hsa-miR-3919	CLIP-seq
MIRT1981284	hsa-miR-3923	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949137	hsa-miR-4282	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949139	hsa-miR-4455	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT1981285	hsa-miR-455-3p	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT1981286	hsa-miR-4778-5p	CLIP-seq
MIRT1981287	hsa-miR-4797-5p	CLIP-seq
MIRT1981288	hsa-miR-486-5p	CLIP-seq
MIRT949151	hsa-miR-513a-3p	CLIP-seq
MIRT949153	hsa-miR-609	CLIP-seq
MIRT949156	hsa-miR-644	CLIP-seq
MIRT1981289	hsa-miR-874	CLIP-seq
MIRT949124	hsa-miR-147	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949133	hsa-miR-3650	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT1981282	hsa-miR-3688-5p	CLIP-seq
MIRT949135	hsa-miR-3911	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949137	hsa-miR-4282	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949139	hsa-miR-4455	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT1981285	hsa-miR-455-3p	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT949151	hsa-miR-513a-3p	CLIP-seq
MIRT949152	hsa-miR-593	CLIP-seq
MIRT949153	hsa-miR-609	CLIP-seq
MIRT949154	hsa-miR-622	CLIP-seq
MIRT949156	hsa-miR-644	CLIP-seq
MIRT949122	hsa-miR-1246	CLIP-seq
MIRT949123	hsa-miR-1290	CLIP-seq
MIRT2520287	hsa-miR-298	CLIP-seq
MIRT949129	hsa-miR-3167	CLIP-seq
MIRT2520288	hsa-miR-3688-3p	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT2520289	hsa-miR-570	CLIP-seq
MIRT949157	hsa-miR-876-5p	CLIP-seq
MIRT949122	hsa-miR-1246	CLIP-seq
MIRT949123	hsa-miR-1290	CLIP-seq
MIRT2520287	hsa-miR-298	CLIP-seq
MIRT949129	hsa-miR-3167	CLIP-seq
MIRT2520288	hsa-miR-3688-3p	CLIP-seq
MIRT949143	hsa-miR-4643	CLIP-seq
MIRT949144	hsa-miR-466	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT1981286	hsa-miR-4778-5p	CLIP-seq
MIRT949150	hsa-miR-4789-3p	CLIP-seq
MIRT2520289	hsa-miR-570	CLIP-seq
MIRT949157	hsa-miR-876-5p	CLIP-seq

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IDA	20133940
GO:0004857	Function	Enzyme inhibitor activity	IDA	30464262, 37696958
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	14607844, 15891768, 16684779, 18420585, 18579519, 20133940, 20412299, 20562859, 20921139, 21094642, 21988832, 22167198, 22965910, 23602568, 25416956, 25852190, 25959826, 26496610, 27173435, 28514442, 32296183, 32814053, 33961781, 35271311, 35914814, 36950384
GO:0005634	Component	Nucleus	IDA	15891768
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	8628263, 15891768
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	20921139
GO:0005856	Component	Cytoskeleton	IEA
GO:0005868	Component	Cytoplasmic dynein complex	IBA
GO:0005868	Component	Cytoplasmic dynein complex	IDA	25830415
GO:0005868	Component	Cytoplasmic dynein complex	IEA
GO:0005868	Component	Cytoplasmic dynein complex	IPI	24986880
GO:0005868	Component	Cytoplasmic dynein complex	ISS
GO:0005874	Component	Microtubule	IEA
GO:0005875	Component	Microtubule associated complex	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019899	Function	Enzyme binding	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030141	Component	Secretory granule	IEA
GO:0030235	Function	Nitric-oxide synthase regulator activity	IEA
GO:0030286	Component	Dynein complex	IEA
GO:0032388	Process	Positive regulation of intracellular transport	NAS	33957056
GO:0035721	Process	Intraciliary retrograde transport	IBA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035861	Component	Site of double-strand break	IDA	37696958
GO:0036487	Function	Nitric-oxide synthase inhibitor activity	IEA
GO:0042326	Process	Negative regulation of phosphorylation	IDA	18579519
GO:0042802	Function	Identical protein binding	IEA
GO:0044458	Process	Motile cilium assembly	IBA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045505	Function	Dynein intermediate chain binding	IBA
GO:0060703	Function	Deoxyribonuclease inhibitor activity	IDA	30464262, 37696958
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0072686	Component	Mitotic spindle	IDA	20133940
GO:0097110	Function	Scaffold protein binding	IEA
GO:0097542	Component	Ciliary tip	IEA
GO:0097542	Component	Ciliary tip	TAS
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:0110025	Process	DNA strand resection involved in replication fork processing	IDA	27814491, 27889449, 29670289, 30612738
GO:0110027	Process	Negative regulation of DNA strand resection involved in replication fork processing	IDA	30464262, 37696958
GO:1904115	Component	Axon cytoplasm	IEA

MIM	HGNC	e!Ensembl
601562	15476	ENSG00000088986

P63167

Protein name

Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)

Protein function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function (By similarity). Cytoplasmic dynein 1

PDB

1CMI , 3ZKE , 3ZKF , 6GZJ , 6GZL , 6RLB , 6SC2 , 7D35 , 8PR0 , 8PR1 , 8PTK , 8RGG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01221	Dynein_light	5 → 88	Dynein light chain type 1	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous (PubMed:8628263). Expressed in testis (PubMed:22965910). {ECO:0000269|PubMed:22965910, ECO:0000269|PubMed:8628263}.

Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Motor proteins Vasopressin-regulated water reabsorption Salmonella infection		Activation of BIM and translocation to mitochondria Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Macroautophagy MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition HSP90 chaperone cycle for steroid hormone receptors (SHR) Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane Intraflagellar transport RHO GTPases Activate Formins Neutrophil degranulation COPI-mediated anterograde transport COPI-independent Golgi-to-ER retrograde traffic Mitotic Prometaphase AURKA Activation by TPX2 HCMV Early Events Aggrephagy EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16061650, 19143023, 21076617, 30012567, 8700801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15663993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23509688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	26155922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30577465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	24661730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26832406, 28922373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25862908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	9522364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12545165, 12759748, 15201975, 16024604, 22799310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	20882354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16533763, 18567993, 24762960, 25720522, 30464262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39350022, 40055377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18773859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18288400, 23783552, 24604602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23509688, 27366946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	28489892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31654775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19380190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27609318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29278276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29278276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	15582286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35619131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31654775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19543515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11118037, 12034501, 12545165, 12792785, 12813468, 14633684, 14647417, 16841372, 17292327, 27271356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11118037, 12792785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20882354, 26832406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16774933, 20882354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12545165, 12759748, 15201975, 16024604, 22799310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11118037, 12792785, 12813468, 14661059, 19826001, 28982593, 9605766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31612067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	1312299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11384102, 12645648, 14680306, 15663993, 16388501, 22110740, 25862908, 27280498, 30012567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12813468, 23049225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12545165, 12792785, 15897869, 17935971, 20882354, 22799310, 26514520, 27299192, 29925878, 8700801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18288400, 23783552, 24604602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12545165, 15201975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16684779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15712180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27609318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16489177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19543515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16680376, 18627284, 23588806, 23908159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10881021, 11025389, 11745418, 12034501, 12545165, 12645648, 12759748, 12792785, 1312299, 14647417, 14661059, 15201975, 15712180, 16680376, 16774933 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15737569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14661059, 17932950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31612067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23681804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23681804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	BEFREE	31009951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11384102, 14680306, 15609334, 15663993, 16388501, 22110740, 25862908, 27280498, 30012567, 8700801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	21076617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12545165, 12645648		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	25862908, 29278276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30231995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19380190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21076617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26112393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12813468, 23049225		★★★★★ ★☆☆☆☆ Found in Text Mining only

DYNLL1 (dynein light chain LC8-type 1)