Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8653
Gene name	DEAD-box helicase 3 Y-linked
Gene symbol	DDX3Y
Synonyms (NCBI Gene)	DBY
Chromosome	Y
Chromosome location	Yq11.221
Summary	The protein encoded by this gene is a member of the DEAD-box RNA helicase family, characterized by nine conserved motifs, included the conserved Asp-Glu-Ala-Asp (DEAD) motif. These motifs are thought to be involved in ATP binding, hydrolysis, RNA binding,

302

Show/Hide all (302)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023122	hsa-miR-124-3p	Microarray	18668037
MIRT032055	hsa-miR-16-5p	Proteomics	18668040
MIRT046978	hsa-miR-221-3p	CLASH	23622248
MIRT052727	hsa-miR-1260b	CLASH	23622248
MIRT558428	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT176346	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT176347	hsa-miR-5680	PAR-CLIP	21572407
MIRT176358	hsa-miR-6871-5p	PAR-CLIP	21572407
MIRT176316	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT176361	hsa-miR-6878-5p	PAR-CLIP	21572407
MIRT558427	hsa-miR-6731-5p	PAR-CLIP	21572407
MIRT558426	hsa-miR-8085	PAR-CLIP	21572407
MIRT558425	hsa-miR-3115	PAR-CLIP	21572407
MIRT176300	hsa-miR-30c-1-3p	PAR-CLIP	21572407
MIRT176289	hsa-miR-30c-2-3p	PAR-CLIP	21572407
MIRT176354	hsa-miR-6788-5p	PAR-CLIP	21572407
MIRT176282	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT440834	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT176209	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440834	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT176209	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT230120	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT230121	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT032055	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT230122	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT176283	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT176284	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT736996	hsa-miR-4287	Microarray	32892695
MIRT558428	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT176346	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT176347	hsa-miR-5680	PAR-CLIP	21572407
MIRT176358	hsa-miR-6871-5p	PAR-CLIP	21572407
MIRT176316	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT176361	hsa-miR-6878-5p	PAR-CLIP	21572407
MIRT558427	hsa-miR-6731-5p	PAR-CLIP	21572407
MIRT558426	hsa-miR-8085	PAR-CLIP	21572407
MIRT558425	hsa-miR-3115	PAR-CLIP	21572407
MIRT176300	hsa-miR-30c-1-3p	PAR-CLIP	21572407
MIRT176289	hsa-miR-30c-2-3p	PAR-CLIP	21572407
MIRT176354	hsa-miR-6788-5p	PAR-CLIP	21572407
MIRT176282	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT930594	hsa-miR-1207-3p	CLIP-seq
MIRT930595	hsa-miR-1267	CLIP-seq
MIRT930596	hsa-miR-1297	CLIP-seq
MIRT930597	hsa-miR-147	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930602	hsa-miR-19a	CLIP-seq
MIRT930603	hsa-miR-19b	CLIP-seq
MIRT930604	hsa-miR-200b	CLIP-seq
MIRT930605	hsa-miR-200c	CLIP-seq
MIRT930606	hsa-miR-203	CLIP-seq
MIRT930607	hsa-miR-217	CLIP-seq
MIRT930608	hsa-miR-224	CLIP-seq
MIRT930609	hsa-miR-2276	CLIP-seq
MIRT930610	hsa-miR-26a	CLIP-seq
MIRT930611	hsa-miR-26b	CLIP-seq
MIRT930612	hsa-miR-29a	CLIP-seq
MIRT930613	hsa-miR-29b	CLIP-seq
MIRT930614	hsa-miR-29c	CLIP-seq
MIRT930615	hsa-miR-3660	CLIP-seq
MIRT930616	hsa-miR-3691-3p	CLIP-seq
MIRT930617	hsa-miR-421	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT930619	hsa-miR-4272	CLIP-seq
MIRT930620	hsa-miR-429	CLIP-seq
MIRT930621	hsa-miR-4418	CLIP-seq
MIRT930622	hsa-miR-4420	CLIP-seq
MIRT930623	hsa-miR-4465	CLIP-seq
MIRT930624	hsa-miR-4490	CLIP-seq
MIRT930625	hsa-miR-4526	CLIP-seq
MIRT930626	hsa-miR-4659a-3p	CLIP-seq
MIRT930627	hsa-miR-4659b-3p	CLIP-seq
MIRT930628	hsa-miR-495	CLIP-seq
MIRT930629	hsa-miR-509-3-5p	CLIP-seq
MIRT930630	hsa-miR-509-5p	CLIP-seq
MIRT930631	hsa-miR-519a	CLIP-seq
MIRT930632	hsa-miR-519b-3p	CLIP-seq
MIRT930633	hsa-miR-519c-3p	CLIP-seq
MIRT930634	hsa-miR-526b	CLIP-seq
MIRT930635	hsa-miR-543	CLIP-seq
MIRT930636	hsa-miR-124	CLIP-seq
MIRT930595	hsa-miR-1267	CLIP-seq
MIRT930637	hsa-miR-129-5p	CLIP-seq
MIRT930596	hsa-miR-1297	CLIP-seq
MIRT930638	hsa-miR-133a	CLIP-seq
MIRT930639	hsa-miR-133b	CLIP-seq
MIRT930597	hsa-miR-147	CLIP-seq
MIRT930640	hsa-miR-15a	CLIP-seq
MIRT930641	hsa-miR-15b	CLIP-seq
MIRT930642	hsa-miR-16	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930643	hsa-miR-186	CLIP-seq
MIRT930644	hsa-miR-195	CLIP-seq
MIRT930645	hsa-miR-199a-5p	CLIP-seq
MIRT930646	hsa-miR-199b-5p	CLIP-seq
MIRT930602	hsa-miR-19a	CLIP-seq
MIRT930603	hsa-miR-19b	CLIP-seq
MIRT738353	hsa-miR-221	CLIP-seq
MIRT738352	hsa-miR-222	CLIP-seq
MIRT930647	hsa-miR-25	CLIP-seq
MIRT930610	hsa-miR-26a	CLIP-seq
MIRT930611	hsa-miR-26b	CLIP-seq
MIRT930648	hsa-miR-3064-5p	CLIP-seq
MIRT930649	hsa-miR-3065-5p	CLIP-seq
MIRT930650	hsa-miR-3138	CLIP-seq
MIRT930651	hsa-miR-32	CLIP-seq
MIRT930652	hsa-miR-337-3p	CLIP-seq
MIRT930653	hsa-miR-363	CLIP-seq
MIRT930654	hsa-miR-3647-3p	CLIP-seq
MIRT930655	hsa-miR-3653	CLIP-seq
MIRT930656	hsa-miR-3658	CLIP-seq
MIRT930657	hsa-miR-367	CLIP-seq
MIRT930658	hsa-miR-3682-5p	CLIP-seq
MIRT930659	hsa-miR-3691-5p	CLIP-seq
MIRT930660	hsa-miR-3913-3p	CLIP-seq
MIRT930661	hsa-miR-3941	CLIP-seq
MIRT930662	hsa-miR-412	CLIP-seq
MIRT930617	hsa-miR-421	CLIP-seq
MIRT930663	hsa-miR-424	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT930619	hsa-miR-4272	CLIP-seq
MIRT738351	hsa-miR-4317	CLIP-seq
MIRT930664	hsa-miR-4325	CLIP-seq
MIRT930622	hsa-miR-4420	CLIP-seq
MIRT930665	hsa-miR-4436a	CLIP-seq
MIRT930623	hsa-miR-4465	CLIP-seq
MIRT930666	hsa-miR-4491	CLIP-seq
MIRT930667	hsa-miR-4524	CLIP-seq
MIRT930668	hsa-miR-4657	CLIP-seq
MIRT930626	hsa-miR-4659a-3p	CLIP-seq
MIRT930627	hsa-miR-4659b-3p	CLIP-seq
MIRT930669	hsa-miR-466	CLIP-seq
MIRT930670	hsa-miR-4668-3p	CLIP-seq
MIRT930671	hsa-miR-4672	CLIP-seq
MIRT930672	hsa-miR-4698	CLIP-seq
MIRT930673	hsa-miR-4700-3p	CLIP-seq
MIRT930674	hsa-miR-4731-3p	CLIP-seq
MIRT930675	hsa-miR-4752	CLIP-seq
MIRT930676	hsa-miR-4764-5p	CLIP-seq
MIRT930677	hsa-miR-4778-3p	CLIP-seq
MIRT930678	hsa-miR-4800-5p	CLIP-seq
MIRT930679	hsa-miR-4801	CLIP-seq
MIRT930680	hsa-miR-497	CLIP-seq
MIRT930681	hsa-miR-503	CLIP-seq
MIRT930682	hsa-miR-506	CLIP-seq
MIRT930683	hsa-miR-511	CLIP-seq
MIRT930684	hsa-miR-520d-5p	CLIP-seq
MIRT930685	hsa-miR-524-5p	CLIP-seq
MIRT930635	hsa-miR-543	CLIP-seq
MIRT930686	hsa-miR-545	CLIP-seq
MIRT930687	hsa-miR-548l	CLIP-seq
MIRT930688	hsa-miR-548n	CLIP-seq
MIRT930689	hsa-miR-548p	CLIP-seq
MIRT930690	hsa-miR-604	CLIP-seq
MIRT930691	hsa-miR-607	CLIP-seq
MIRT930692	hsa-miR-646	CLIP-seq
MIRT930693	hsa-miR-647	CLIP-seq
MIRT930694	hsa-miR-892b	CLIP-seq
MIRT930695	hsa-miR-92a	CLIP-seq
MIRT930696	hsa-miR-92b	CLIP-seq
MIRT738353	hsa-miR-221	CLIP-seq
MIRT738352	hsa-miR-222	CLIP-seq
MIRT738351	hsa-miR-4317	CLIP-seq
MIRT930637	hsa-miR-129-5p	CLIP-seq
MIRT930638	hsa-miR-133a	CLIP-seq
MIRT930639	hsa-miR-133b	CLIP-seq
MIRT1975457	hsa-miR-1537	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930602	hsa-miR-19a	CLIP-seq
MIRT930603	hsa-miR-19b	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT930683	hsa-miR-511	CLIP-seq
MIRT930635	hsa-miR-543	CLIP-seq
MIRT930688	hsa-miR-548n	CLIP-seq
MIRT1975458	hsa-miR-548t	CLIP-seq
MIRT1975459	hsa-miR-561	CLIP-seq
MIRT930594	hsa-miR-1207-3p	CLIP-seq
MIRT2210896	hsa-miR-1227	CLIP-seq
MIRT930636	hsa-miR-124	CLIP-seq
MIRT930595	hsa-miR-1267	CLIP-seq
MIRT2210897	hsa-miR-1273g	CLIP-seq
MIRT930637	hsa-miR-129-5p	CLIP-seq
MIRT930596	hsa-miR-1297	CLIP-seq
MIRT2210898	hsa-miR-1301	CLIP-seq
MIRT2210899	hsa-miR-1323	CLIP-seq
MIRT930597	hsa-miR-147	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930645	hsa-miR-199a-5p	CLIP-seq
MIRT930646	hsa-miR-199b-5p	CLIP-seq
MIRT930602	hsa-miR-19a	CLIP-seq
MIRT930603	hsa-miR-19b	CLIP-seq
MIRT930604	hsa-miR-200b	CLIP-seq
MIRT930605	hsa-miR-200c	CLIP-seq
MIRT930607	hsa-miR-217	CLIP-seq
MIRT930610	hsa-miR-26a	CLIP-seq
MIRT930611	hsa-miR-26b	CLIP-seq
MIRT930612	hsa-miR-29a	CLIP-seq
MIRT930613	hsa-miR-29b	CLIP-seq
MIRT930614	hsa-miR-29c	CLIP-seq
MIRT930649	hsa-miR-3065-5p	CLIP-seq
MIRT2210900	hsa-miR-3074-3p	CLIP-seq
MIRT2210901	hsa-miR-340	CLIP-seq
MIRT2210902	hsa-miR-3622b-5p	CLIP-seq
MIRT930654	hsa-miR-3647-3p	CLIP-seq
MIRT2210903	hsa-miR-382	CLIP-seq
MIRT2210904	hsa-miR-3921	CLIP-seq
MIRT930617	hsa-miR-421	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT2210905	hsa-miR-4264	CLIP-seq
MIRT930619	hsa-miR-4272	CLIP-seq
MIRT930620	hsa-miR-429	CLIP-seq
MIRT2210906	hsa-miR-4307	CLIP-seq
MIRT930621	hsa-miR-4418	CLIP-seq
MIRT2210907	hsa-miR-4427	CLIP-seq
MIRT2210908	hsa-miR-4433	CLIP-seq
MIRT2210909	hsa-miR-4459	CLIP-seq
MIRT930623	hsa-miR-4465	CLIP-seq
MIRT2210910	hsa-miR-4480	CLIP-seq
MIRT930624	hsa-miR-4490	CLIP-seq
MIRT2210911	hsa-miR-4527	CLIP-seq
MIRT2210912	hsa-miR-4642	CLIP-seq
MIRT2210913	hsa-miR-4653-5p	CLIP-seq
MIRT2210914	hsa-miR-4660	CLIP-seq
MIRT2210915	hsa-miR-4666-5p	CLIP-seq
MIRT930670	hsa-miR-4668-3p	CLIP-seq
MIRT2210916	hsa-miR-4680-3p	CLIP-seq
MIRT2210917	hsa-miR-4704-3p	CLIP-seq
MIRT2210918	hsa-miR-4719	CLIP-seq
MIRT2210919	hsa-miR-4720-3p	CLIP-seq
MIRT2210920	hsa-miR-4768-3p	CLIP-seq
MIRT2210921	hsa-miR-4773	CLIP-seq
MIRT2210922	hsa-miR-4775	CLIP-seq
MIRT2210923	hsa-miR-4804-3p	CLIP-seq
MIRT2210924	hsa-miR-487a	CLIP-seq
MIRT930628	hsa-miR-495	CLIP-seq
MIRT2210925	hsa-miR-5047	CLIP-seq
MIRT930682	hsa-miR-506	CLIP-seq
MIRT930629	hsa-miR-509-3-5p	CLIP-seq
MIRT930630	hsa-miR-509-5p	CLIP-seq
MIRT930635	hsa-miR-543	CLIP-seq
MIRT930688	hsa-miR-548n	CLIP-seq
MIRT2210926	hsa-miR-548o	CLIP-seq
MIRT1975458	hsa-miR-548t	CLIP-seq
MIRT1975459	hsa-miR-561	CLIP-seq
MIRT2210927	hsa-miR-587	CLIP-seq
MIRT2210928	hsa-miR-875-5p	CLIP-seq
MIRT930594	hsa-miR-1207-3p	CLIP-seq
MIRT930637	hsa-miR-129-5p	CLIP-seq
MIRT930596	hsa-miR-1297	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930607	hsa-miR-217	CLIP-seq
MIRT930609	hsa-miR-2276	CLIP-seq
MIRT930610	hsa-miR-26a	CLIP-seq
MIRT930611	hsa-miR-26b	CLIP-seq
MIRT930649	hsa-miR-3065-5p	CLIP-seq
MIRT930617	hsa-miR-421	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT930619	hsa-miR-4272	CLIP-seq
MIRT930621	hsa-miR-4418	CLIP-seq
MIRT2210907	hsa-miR-4427	CLIP-seq
MIRT930623	hsa-miR-4465	CLIP-seq
MIRT930624	hsa-miR-4490	CLIP-seq
MIRT2210916	hsa-miR-4680-3p	CLIP-seq
MIRT930629	hsa-miR-509-3-5p	CLIP-seq
MIRT930630	hsa-miR-509-5p	CLIP-seq
MIRT930634	hsa-miR-526b	CLIP-seq
MIRT930635	hsa-miR-543	CLIP-seq
MIRT930683	hsa-miR-511	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT930686	hsa-miR-545	CLIP-seq
MIRT930598	hsa-miR-181a	CLIP-seq
MIRT930599	hsa-miR-181b	CLIP-seq
MIRT930600	hsa-miR-181c	CLIP-seq
MIRT930601	hsa-miR-181d	CLIP-seq
MIRT930618	hsa-miR-4262	CLIP-seq
MIRT930670	hsa-miR-4668-3p	CLIP-seq
MIRT2514813	hsa-miR-3143	CLIP-seq
MIRT2514814	hsa-miR-342-3p	CLIP-seq
MIRT2210911	hsa-miR-4527	CLIP-seq
MIRT2210919	hsa-miR-4720-3p	CLIP-seq
MIRT2210922	hsa-miR-4775	CLIP-seq
MIRT2210923	hsa-miR-4804-3p	CLIP-seq
MIRT930635	hsa-miR-543	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IBA
GO:0003724	Function	RNA helicase activity	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0007276	Process	Gamete generation	IBA
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0043186	Component	P granule	IBA

MIM	HGNC	e!Ensembl
400010	2699	ENSG00000067048

O15523

Protein name

ATP-dependent RNA helicase DDX3Y (EC 3.6.4.13) (DEAD box protein 3, Y-chromosomal)

Protein function

Probable ATP-dependent RNA helicase. During immune response, may enhance IFNB1 expression via IRF3/IRF7 pathway (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00270	DEAD	202 → 390	DEAD/DEAH box helicase	Domain
PF00271	Helicase_C	424 → 534	Helicase conserved C-terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at the mRNA level, with highest levels in testis (PubMed:9381176). Testis-specific (at protein level). Expressed predominantly in spermatogonia, but occasionally detected in some pre-leptotene/leptotene spermatocytes (

Sequence

MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGW
SCSKDKDAYSSFGSRDSRGKPGYFSERGSGSRGRFDDRGRSDYDGIGNRERPGFGRFERS
GHSRWCDKSVEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENF
SDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQI
YTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYG
GADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIR
RIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWV
EDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREE
ALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLAT
SFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDY
RQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

Sequence length

660

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Non-obstructive azoospermia	Likely pathogenic	rs2521791712, rs2521805596, rs2521805721, rs2521809031	RCV003127204 RCV003127205 RCV003127206 RCV003127207	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME Y MICRODELETION SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DDX3Y-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPERMATOGENIC FAILURE, NONOBSTRUCTIVE, Y-LINKED	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPERMATOGENIC FAILURE, Y-LINKED, 2	—	ClinVar, HPO ClinVar, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR AZOOSPERMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	36928034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	11097428, 28190795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	36997603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38217953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30865384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22365286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25366777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36928034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30865384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40362575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, 46,XY	Gonadal Dysgenesis	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, Mixed	Gonadal Dysgenesis	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadoblastoma	Gonadoblastoma	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11929796, 14512314, 17085304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11929796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20031959, 35346191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24741625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36241908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34535544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38217953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31205025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oligospermia	Oligospermia	BEFREE	10507722, 11097428, 11695273, 17881721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial chromosome Y deletion	Partial Chromosome Y Deletion	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25366777, 36194576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	22466863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	38217953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spermatogenic Failure, Nonobstructive, Y-Linked	Nonobstructive Spermatogenic Failure, Y-Linked	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Swyer Syndrome	Swyer Syndrome	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	30753444		★★★★★ ★☆☆☆☆ Found in Text Mining only

DDX3Y (DEAD-box helicase 3 Y-linked)