SOCS1 (suppressor of cytokine signaling 1)

Gene

• Entrez ID: 8651
• Gene name: Suppressor of cytokine signaling 1
• Gene symbol: SOCS1
• Synonyms (NCBI Gene): AISIMD, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP-3, TIP3
• Chromosome: 16
• Chromosome location: 16p13.13
• Summary: This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be ind

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004336	hsa-miR-19b-3p	Luciferase reporter assay, Western blot	18728182
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, Western blot	18728182
MIRT000456	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	20354188
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay	18728182
MIRT004336	hsa-miR-19b-3p	Luciferase reporter assay	18728182
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay	22771905
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay	22771905
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007132	hsa-miR-30c-5p	qRT-PCR	23418453
MIRT000456	hsa-miR-155-5p	Proteomics	18668040
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23621248
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23621248
MIRT000456	hsa-miR-155-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23436936
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24351865
MIRT000456	hsa-miR-155-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23436936
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24351865
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	22291592
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	22291592
MIRT492208	hsa-miR-331-3p	PAR-CLIP	22291592
MIRT492205	hsa-miR-4495	PAR-CLIP	22291592
MIRT492204	hsa-miR-379-3p	PAR-CLIP	22291592
MIRT492203	hsa-miR-411-3p	PAR-CLIP	22291592
MIRT492202	hsa-miR-380-3p	PAR-CLIP	22291592
MIRT492201	hsa-miR-8060	PAR-CLIP	22291592
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	22291592
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT492196	hsa-miR-503-3p	PAR-CLIP	22291592
MIRT492195	hsa-miR-5087	PAR-CLIP	22291592
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	22291592
MIRT492191	hsa-miR-527	PAR-CLIP	22291592
MIRT492190	hsa-miR-2113	PAR-CLIP	22291592
MIRT006373	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT492220	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT492219	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT492218	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT492217	hsa-miR-4500	PAR-CLIP	23592263
MIRT492216	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT492215	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT492214	hsa-miR-4458	PAR-CLIP	23592263
MIRT492213	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT492212	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT492211	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492207	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT492206	hsa-miR-4779	PAR-CLIP	23592263
MIRT492205	hsa-miR-4495	PAR-CLIP	23592263
MIRT492204	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT492203	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT492202	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT492201	hsa-miR-8060	PAR-CLIP	23592263
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	23592263
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	23592263
MIRT492198	hsa-miR-3689d	PAR-CLIP	23592263
MIRT492197	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT492196	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT492195	hsa-miR-5087	PAR-CLIP	23592263
MIRT492194	hsa-miR-4266	PAR-CLIP	23592263
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT492191	hsa-miR-527	PAR-CLIP	23592263
MIRT492190	hsa-miR-2113	PAR-CLIP	23592263
MIRT000456	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT000456	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT004337	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT004336	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT492209	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT006325	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT007132	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT053037	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT492210	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT731736	hsa-miR-142-5p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT731736	hsa-miR-142-5p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT000456	hsa-miR-155-5p	Western blot	27470349
MIRT000456	hsa-miR-155-5p	qRT-PCR, Western blot	25998827
MIRT000456	hsa-miR-155-5p	ELISA, qRT-PCR, Western blot	27817193
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	27811366
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	27811366
MIRT438547	hsa-miR-221-3p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33955508
MIRT492219	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33005103
MIRT492219	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33005103
MIRT492210	hsa-miR-30e-5p	Luciferase reporter assay, Immunoprecipitaion (IP), ELISA	32688283
MIRT492219	hsa-let-7b-5p	ELISA, Luciferase reporter assay, qRT-PCR	33005103
MIRT731736	hsa-miR-142-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, ELISA	31949659
MIRT736464	hsa-miR-222-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31637892
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	22291592
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	22291592
MIRT492208	hsa-miR-331-3p	PAR-CLIP	22291592
MIRT492205	hsa-miR-4495	PAR-CLIP	22291592
MIRT492204	hsa-miR-379-3p	PAR-CLIP	22291592
MIRT492203	hsa-miR-411-3p	PAR-CLIP	22291592
MIRT492202	hsa-miR-380-3p	PAR-CLIP	22291592
MIRT492201	hsa-miR-8060	PAR-CLIP	22291592
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	22291592
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT492196	hsa-miR-503-3p	PAR-CLIP	22291592
MIRT492195	hsa-miR-5087	PAR-CLIP	22291592
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	22291592
MIRT492191	hsa-miR-527	PAR-CLIP	22291592
MIRT492190	hsa-miR-2113	PAR-CLIP	22291592
MIRT006373	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT492220	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT492219	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT492218	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT492217	hsa-miR-4500	PAR-CLIP	23592263
MIRT492216	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT492215	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT492214	hsa-miR-4458	PAR-CLIP	23592263
MIRT492213	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT492212	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT492211	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492207	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT492206	hsa-miR-4779	PAR-CLIP	23592263
MIRT492205	hsa-miR-4495	PAR-CLIP	23592263
MIRT492204	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT492203	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT492202	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT492201	hsa-miR-8060	PAR-CLIP	23592263
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	23592263
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	23592263
MIRT492198	hsa-miR-3689d	PAR-CLIP	23592263
MIRT492197	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT492196	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT492195	hsa-miR-5087	PAR-CLIP	23592263
MIRT492194	hsa-miR-4266	PAR-CLIP	23592263
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT492191	hsa-miR-527	PAR-CLIP	23592263
MIRT492190	hsa-miR-2113	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36199788
MIRT755552	hsa-miR-6794-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	38521953
MIRT755606	miR-30d	Western blotting, qRT-PCR, Immunofluorescence	36704201
MIRT1378493	hsa-let-7a	CLIP-seq
MIRT1378494	hsa-let-7b	CLIP-seq
MIRT1378495	hsa-let-7c	CLIP-seq
MIRT1378496	hsa-let-7d	CLIP-seq
MIRT1378497	hsa-let-7e	CLIP-seq
MIRT1378498	hsa-let-7f	CLIP-seq
MIRT1378499	hsa-let-7g	CLIP-seq
MIRT1378500	hsa-let-7i	CLIP-seq
MIRT1378501	hsa-miR-19a	CLIP-seq
MIRT1378502	hsa-miR-19b	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT1378508	hsa-miR-324-5p	CLIP-seq
MIRT1378509	hsa-miR-361-3p	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT1378511	hsa-miR-495	CLIP-seq
MIRT1378512	hsa-miR-566	CLIP-seq
MIRT1378513	hsa-miR-569	CLIP-seq
MIRT1378514	hsa-miR-922	CLIP-seq
MIRT1378515	hsa-miR-98	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT2335849	hsa-miR-149	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT1378493	hsa-let-7a	CLIP-seq
MIRT1378494	hsa-let-7b	CLIP-seq
MIRT1378495	hsa-let-7c	CLIP-seq
MIRT1378496	hsa-let-7d	CLIP-seq
MIRT1378497	hsa-let-7e	CLIP-seq
MIRT1378498	hsa-let-7f	CLIP-seq
MIRT1378499	hsa-let-7g	CLIP-seq
MIRT1378500	hsa-let-7i	CLIP-seq
MIRT2335849	hsa-miR-149	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT1378515	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GLI1	Activation	24058673
GLI2	Activation	24058673
HIF1A	Activation	20003295
IRF1	Activation	20644166
SP1	Activation	20644166
STAT3	Activation	14630083;20003295;20357037
STAT6	Unknown	15199062;18342537

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	9202125
GO:0005126	Function	Cytokine receptor binding	IBA
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	9727029
GO:0005515	Function	Protein binding	IPI	16273093, 16643902, 17183367, 18172216, 23401859, 31980649, 32296183, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	TAS	9202126
GO:0005829	Component	Cytosol	TAS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019210	Function	Kinase inhibitor activity	IEA
GO:0019210	Function	Kinase inhibitor activity	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0019901	Function	Protein kinase binding	IPI	9727029
GO:0030225	Process	Macrophage differentiation	IMP	32634427
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032502	Process	Developmental process	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043377	Process	Negative regulation of CD8-positive, alpha-beta T cell differentiation	IEA
GO:0043377	Process	Negative regulation of CD8-positive, alpha-beta T cell differentiation	ISS
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IMP	22387553
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	25019494
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	NAS	9727029
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0071230	Process	Cellular response to amino acid stimulus	IEA

Other IDs

• MIM: 603597
• HGNC: 19383
• e!Ensembl: ENSG00000185338

Protein

• UniProt ID: O15524
• Protein name: Suppressor of cytokine signaling 1 (SOCS-1) (JAK-binding protein) (JAB) (STAT-induced STAT inhibitor 1) (SSI-1) (Tec-interacting protein 3) (TIP-3)
• Protein function: Essential negative regulator of type I and type II interferon (IFN) signaling, as well as that of other cytokines, including IL2, IL4, IL6 and leukemia inhibitory factor (LIF) (PubMed:32499645, PubMed:33087723). Downregulates cytokine signaling
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	79 → 154	SH2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes.
• Sequence:

  MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
  HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
  SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
  RIVATVGRENLARIPLNPVLRDYLSSFPFQI

• Sequence length: 211

Pathways

KEGG:

Ubiquitin mediated proteolysis
Osteoclast differentiation
JAK-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Growth hormone synthesis, secretion and action
Toxoplasmosis
MicroRNAs in cancer

Reactome:

Interleukin-7 signaling
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
Interleukin-4 and Interleukin-13 signaling
Interferon gamma signaling
Regulation of IFNG signaling
Interferon alpha/beta signaling
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoimmune hemolytic anemia	Pathogenic	rs1470306246, rs2069587477	RCV001254899 RCV001254898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoimmune thrombocytopenia	Pathogenic	rs1470306246, rs2069587477	RCV001254899 RCV001254898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoimmune thrombocytopenic purpura	Pathogenic	rs1244284678	RCV001254897	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoinflammatory syndrome with immunodeficiency	Likely pathogenic; Pathogenic	rs2141125120, rs2141124542, rs2141124327, rs2069579242, rs1470306246, rs1244284678, rs2069587477	RCV001526868 RCV001526867 RCV003388891 RCV003991985 RCV004719119 RCV006249731 RCV001526870	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AUTOINFLAMMATORY SYNDROME, FAMILIAL, WITHOUT IMMUNODEFICIENCY	Likely pathogenic; Pathogenic	rs2069578995, rs1244284678, rs2069586831	RCV001526873 RCV001526871 RCV001526872	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant lymphoma, large B-cell, diffuse	Pathogenic	rs906125295	RCV003449012	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs906125295	RCV004673896	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Systemic lupus erythematosus	Likely pathogenic; Pathogenic	rs2069578995, rs2069586831	RCV001254901 RCV001254900	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATORY SYNDROME, FAMILIAL, WITH OR WITHOUT IMMUNODEFICIENCY	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET AUTOIMMUNITY-AUTOINFLAMMATION-IMMUNODEFICIENCY SYNDROME DUE TO SOCS1 HAPLOINSUFFICIENCY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SOCS1-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	24997329		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	14762685, 29415891		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14762685		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29937734		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12865927, 17376806, 24726456		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	25853848		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28302137, 31407320		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16532038, 17652621, 19734449		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24058673		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	14630083		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	21079688		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29471302		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25286386	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31718618		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	32853638	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	20064913, 24532142, 26812031		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27496707		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23545584, 23994402, 26159489, 30314869		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29928998	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	38157076	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15535835, 20538233, 24351865, 32670294, 32998457, 40024253	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	16421738		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17099141, 25630941		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17099141		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27338192	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33446603	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21339190	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28035384		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23545584, 23994402, 26159489, 30314869		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20622265, 22257840, 23151489, 28900678, 29990515, 31105556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	32853638, 33087723, 40024253	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	40024253	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16287070, 19734449, 28739740, 31407320		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16287070, 17867599, 18035697		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17376806	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28899632		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25207681, 29990515		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	25207681	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	31842857		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31842857	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21599969		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34930159	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20433750, 27470349, 28739740, 29928425, 30453988, 30468477		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12888825, 20433750, 25104439, 30453988, 30468477, 35859293, 36189796	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35524373	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14617776, 24460337, 35295043	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16532038, 24726456, 28228755		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	12888825	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10551323, 12456503, 12865927, 12937151, 15354212, 18161048, 22994783, 23941364, 28704535, 30689554, 34045534, 34319031, 35168698	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12888825	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21599969		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	20164024		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16007169, 23962256		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	12865927	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17898043, 33173957	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28445952		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25893382, 29891489		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	26180928		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30342297		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	12759242, 20190752	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35856366	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15021916, 21935712, 23877655, 25849377, 27754760, 28215653, 31038361, 31409905		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15021916, 21935712, 23877655, 25849377, 27754760, 28215653, 31038361, 31409905		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	28899632		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24058673		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28146070, 35563301	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18656467		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16598306, 22238073		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	17030374, 17230231, 18318760, 18815196, 23111066, 23430957, 28753604		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	31169909		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	23375208		★☆☆☆☆ Found in Text Mining only
Chuvash erythrocytosis	Chuvash Erythrocytosis	BEFREE	21685897		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	14614012, 15235874, 16618406, 21145824, 23164156, 23941364		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29482156		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22467146, 25998827, 35946880	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26462859	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14719065, 15074307, 15793636, 17339237, 18084250, 21625944, 24460337, 26391193, 27133036		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15074307		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17474983, 17591929, 18834226, 19002263, 22121102, 25167802, 25339048, 27613835, 28469732, 35137551, 35295043, 35321782	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24726456		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24636575, 25045829, 29018442		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17898043		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23545584, 29398326		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23545584, 29398326		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23545584, 29398326		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	16421738		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22467146	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26462859		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	17510435		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17726036, 21352802, 22576756, 28373981		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	23430954		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27640899		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	38157076	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	25761610	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	25761610, 30459600		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	12077274		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12882919, 19344732, 29151123, 29540859, 31344857, 31653894		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12882919, 19344732, 29151123, 29540859, 31344857, 31653894		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34951048	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28934129	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12882919, 15757867, 16426235, 19215277		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19215277, 28842216, 29228585, 29398326, 29630758		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27609616, 31599432		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23296022, 27198204, 28302137, 31407320		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12888825		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25761610, 30459600		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	27338192	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34368875	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	36459028	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15197228, 30097285		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	25045829		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26456195		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	40024253	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29623544		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17438093, 30811476, 30990849		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17438093		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30811476, 37315184, 40076502	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33476981	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17438093, 18770864, 30811476, 30990849		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21339190, 32516488	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25123164		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23941364	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	22147985	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	28704535	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12601549		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	12601549		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	28842621		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	17412760		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	24204690		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16532038, 17652621, 19734449		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	16532038, 17652621, 17867599		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17652621, 19734449, 26336985, 28082443, 29650799, 30213827, 31407320, 32079702	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	28857282		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	36862882	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17198680, 24890164, 25997387		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18355908		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27796698		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29018442		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	33087723, 34421895, 40024253	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	30048621		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	17376806		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31838956		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31838956	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27216615, 29130998, 31707448		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21625944		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27609616, 31097789		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	20164024	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23437123		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	25642632		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14616969, 15580314, 23430957, 29916533		★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	33087723	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15495254, 24473562, 29415891, 34789073, 39270538	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12759928, 14762685, 15327527, 15495254, 15801956, 18318760, 19546476, 28753595, 29916533, 29991678		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14630083, 21079688		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11322203, 11326271, 12183076, 12456503, 12601549, 12759928, 12865927, 12937151, 14614012, 15074307, 15121754, 15197228, 15235874, 16310278, 16618406, 16706806, 17001312, 18639978, 18843197, 20112070, 20648401, 21145824, 22318090, 22994783, 23242177, 23941364, 25853848, 26725321, 27061542, 27271356, 28661477, 29085209, 30097285, 30689554, 31154249		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12759928, 14614012, 18639978		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	14614012, 15235874, 16618406, 20648401, 21145824, 23164156, 23941364, 30689554		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30689554	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22257840	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28146070	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	24727541, 25045829		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24727541	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29852455		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26725321		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22859983	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25986394, 26055806, 37797401, 40024253	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18820827, 20064913, 22859983, 25330931, 27781323, 29085365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	28620377, 31130957		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	LHGDN	18538318		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29527785	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12456503, 16532038, 23296022		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17867599		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21418178, 23296022, 37495858	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	19734449, 34791836, 37493986	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19734449		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	27144517		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	22488585		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	24204690		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29898456		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15361843, 20433750, 27470349, 28739740, 29928425, 30453988, 30468477		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26456195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16007169, 23962256		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25893382, 29891489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12865927, 15121754, 23817566, 29916533		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19342366, 27779203, 28235401, 28693582, 29506516		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21072904, 22095154, 23621248, 25261987, 26180928, 31709719		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21599969		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12759928, 15327527, 15801956, 16029449, 16978223, 19342366, 20622265, 21935712, 22318090, 23601686, 23741392, 24204690, 24460337, 26391193, 26811119, 27061542, 28228755, 28739740, 28900678, 30285793, 31101761, 31105556		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15021916, 21935712, 23877655, 25849377, 27754760, 28215653, 31038361, 31409905		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18832519, 21738611		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15361843, 17888401		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	16287070, 19734449, 30211726		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24058673		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	24058673	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	15373779, 28466787		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15373779, 18627528, 19047140, 20398276, 25322862, 26173926, 28079159, 28466787		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15373779, 19047140		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15373779, 16374457, 19223509, 20398276	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27640899		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27987139	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36609306	Associate	★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31184345		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15580314, 19727727		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25039241	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12456503, 15121754, 15580314, 16082380, 18728182, 19548309, 19727727, 20651070, 24091729, 25185784, 28369102		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12456503, 14976049, 16082380		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12456503, 14976049, 15354212, 20651070, 23894411, 24091729, 28369102, 31868118	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20112030, 21653641, 26203907	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21653641, 21716315, 24951315, 25623250, 25701091, 28302134		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25701091		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	30144205	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15801956, 16029449, 16978223, 19546476, 25123164		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15801956, 16029449, 16978223, 26025663	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	14616969, 14754605, 17315216, 19222642, 22787435		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	17315216		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	17230231, 18815196		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	18815196, 22517899, 23111066, 23430957, 28753604		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	18815196	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31207208		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23375208		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30816302	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26455487	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12601549, 12865927, 14517841, 14614012, 14719065, 15021916, 15074307, 15121754, 15327527, 15373779, 15386345, 15572583, 16029449, 16532038, 16706806, 16978223, 17376806, 17591929, 18843197, 19342366, 20080139, 20164024, 20433750, 20622265, 20648401, 22025331, 22366886, 22532243, 22994783, 23621248, 23630584, 23877655, 23906298, 23941364, 24091729, 24859205, 25092897, 25820993, 26391193, 26725321, 26811119, 26841929, 27356265, 27779203, 28035384, 28038963, 28215653, 28235401, 28466787, 28753595, 28753604, 28900678, 29527785, 29916533, 29928425, 30144205, 30475253, 30689554, 30761449, 31038361, 31557897		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	25330931		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	22252769	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31063584		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17510435		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31013265, 31717271		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23962256, 25604748, 29268708		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19215277, 27704310, 31717271		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36609306	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	38384018	Associate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	25207681		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	23553658		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21352802, 28373981	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24238405	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29019549		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31364725		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31364725	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	25424734		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	25424734	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25893382, 29891489		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	27779203		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12865927, 23817566, 29916533		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15121754		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12865927	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23089475		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	15572854, 21079688	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29019549, 31169909		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29019549		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36456933	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	16421738		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	23403324		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17030374, 18623127		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	36459028	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	34349769	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	22257840, 28146070		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	28146070		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19342366, 27779203, 28235401, 28693582, 29506516		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19342366, 28235401	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	15720527, 23702664		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22482804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18355908		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25997387		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	25207681		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17898043		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28620377		★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	28558309		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	12359053	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15535835, 17726036, 18820827, 20538233, 22576756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	21356378		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21356378	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	25986394, 35545753	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31484735	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28679957, 30972748		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29655283, 40024253	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	40024253	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25761610		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16432158, 26502748, 28445952		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16432158		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28233302, 29042418, 31728180		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23437123	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32719094, 33892811, 34398824, 34853622, 35610596, 38384018	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16007169		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	LHGDN	14614901		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31013265		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15386345, 21072904, 23621248, 25261987, 26180928, 31709719		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15354212, 21072904, 31709719	Associate	★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	29928998		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	26990535	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	18623127, 26990535		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28643757	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31718618	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16452205	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29527785, 30873664, 31456112		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29527785, 37378935, 37720228	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17589943, 24985978, 25998827, 26462859		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17589943		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21599969	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	34670303	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25849377	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33203661	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	21294722		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	27478014	Inhibit	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30721702		★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	31185757		★☆☆☆☆ Found in Text Mining only