NCOA1 (nuclear receptor coactivator 1)

Gene

• Entrez ID: 8648
• Gene name: Nuclear receptor coactivator 1
• Gene symbol: NCOA1
• Synonyms (NCBI Gene): F-SRC-1, KAT13A, RIP160, SRC1, bHLHe42, bHLHe74
• Chromosome: 2
• Chromosome location: 2p23.3
• Summary: The protein encoded by this gene acts as a transcriptional coactivator for steroid and nuclear hormone receptors. It is a member of the p160/steroid receptor coactivator (SRC) family and like other family members has histone acetyltransferase activity and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006106	hsa-miR-22-3p	Luciferase reporter assay, Western blot	21798241
MIRT006106	hsa-miR-22-3p	Luciferase reporter assay, Western blot	21798241
MIRT006106	hsa-miR-22-3p	Luciferase reporter assay, Western blot	21798241
MIRT051725	hsa-let-7d-5p	CLASH	23622248
MIRT302078	hsa-miR-34a-5p	Microarray, qRT-PCR	22815788
MIRT655971	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT006106	hsa-miR-22-3p	qRT-PCR, Western blot	26244872
MIRT735019	hsa-miR-34c-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	33842985
MIRT655971	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT1176638	hsa-miR-200b	CLIP-seq
MIRT1176639	hsa-miR-200c	CLIP-seq
MIRT1176640	hsa-miR-362-5p	CLIP-seq
MIRT1176641	hsa-miR-369-3p	CLIP-seq
MIRT1176642	hsa-miR-374a	CLIP-seq
MIRT1176643	hsa-miR-374b	CLIP-seq
MIRT1176644	hsa-miR-429	CLIP-seq
MIRT1176645	hsa-miR-4293	CLIP-seq
MIRT1176646	hsa-miR-4636	CLIP-seq
MIRT1176647	hsa-miR-4699-3p	CLIP-seq
MIRT1176648	hsa-miR-4768-5p	CLIP-seq
MIRT1176649	hsa-miR-4795-3p	CLIP-seq
MIRT1176650	hsa-miR-500b	CLIP-seq
MIRT1176651	hsa-miR-501-5p	CLIP-seq
MIRT1176652	hsa-miR-562	CLIP-seq
MIRT1176653	hsa-miR-596	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT1176655	hsa-miR-1283	CLIP-seq
MIRT1176656	hsa-miR-1301	CLIP-seq
MIRT1176657	hsa-miR-1343	CLIP-seq
MIRT1176658	hsa-miR-137	CLIP-seq
MIRT1176659	hsa-miR-1914	CLIP-seq
MIRT1176660	hsa-miR-216a	CLIP-seq
MIRT1176661	hsa-miR-219-5p	CLIP-seq
MIRT1176662	hsa-miR-223	CLIP-seq
MIRT1176663	hsa-miR-2277-3p	CLIP-seq
MIRT1176664	hsa-miR-25	CLIP-seq
MIRT1176665	hsa-miR-3074-5p	CLIP-seq
MIRT1176666	hsa-miR-3121-5p	CLIP-seq
MIRT1176667	hsa-miR-3123	CLIP-seq
MIRT1176668	hsa-miR-3124-3p	CLIP-seq
MIRT1176669	hsa-miR-3148	CLIP-seq
MIRT1176670	hsa-miR-3176	CLIP-seq
MIRT1176671	hsa-miR-3182	CLIP-seq
MIRT1176672	hsa-miR-32	CLIP-seq
MIRT1176673	hsa-miR-320e	CLIP-seq
MIRT1176674	hsa-miR-329	CLIP-seq
MIRT1176675	hsa-miR-338-5p	CLIP-seq
MIRT1176676	hsa-miR-33a	CLIP-seq
MIRT1176677	hsa-miR-33b	CLIP-seq
MIRT1176678	hsa-miR-3613-3p	CLIP-seq
MIRT1176679	hsa-miR-362-3p	CLIP-seq
MIRT1176680	hsa-miR-363	CLIP-seq
MIRT1176681	hsa-miR-3646	CLIP-seq
MIRT1176682	hsa-miR-3647-3p	CLIP-seq
MIRT1176683	hsa-miR-3662	CLIP-seq
MIRT1176684	hsa-miR-367	CLIP-seq
MIRT1176641	hsa-miR-369-3p	CLIP-seq
MIRT1176642	hsa-miR-374a	CLIP-seq
MIRT1176643	hsa-miR-374b	CLIP-seq
MIRT1176685	hsa-miR-377	CLIP-seq
MIRT1176686	hsa-miR-3922-3p	CLIP-seq
MIRT1176687	hsa-miR-3925-5p	CLIP-seq
MIRT1176688	hsa-miR-3941	CLIP-seq
MIRT1176689	hsa-miR-410	CLIP-seq
MIRT1176690	hsa-miR-4277	CLIP-seq
MIRT1176645	hsa-miR-4293	CLIP-seq
MIRT1176691	hsa-miR-4325	CLIP-seq
MIRT1176692	hsa-miR-4330	CLIP-seq
MIRT1176693	hsa-miR-4445	CLIP-seq
MIRT1176694	hsa-miR-4643	CLIP-seq
MIRT1176695	hsa-miR-4652-3p	CLIP-seq
MIRT1176696	hsa-miR-4668-5p	CLIP-seq
MIRT1176647	hsa-miR-4699-3p	CLIP-seq
MIRT1176697	hsa-miR-4699-5p	CLIP-seq
MIRT1176698	hsa-miR-4705	CLIP-seq
MIRT1176699	hsa-miR-4719	CLIP-seq
MIRT1176700	hsa-miR-4731-3p	CLIP-seq
MIRT1176648	hsa-miR-4768-5p	CLIP-seq
MIRT1176701	hsa-miR-4775	CLIP-seq
MIRT1176702	hsa-miR-4777-5p	CLIP-seq
MIRT1176703	hsa-miR-4782-3p	CLIP-seq
MIRT1176704	hsa-miR-4797-5p	CLIP-seq
MIRT1176705	hsa-miR-4801	CLIP-seq
MIRT1176706	hsa-miR-496	CLIP-seq
MIRT1176707	hsa-miR-498	CLIP-seq
MIRT1176708	hsa-miR-5047	CLIP-seq
MIRT1176709	hsa-miR-508-3p	CLIP-seq
MIRT1176710	hsa-miR-513a-3p	CLIP-seq
MIRT1176711	hsa-miR-518d-5p	CLIP-seq
MIRT1176712	hsa-miR-519b-5p	CLIP-seq
MIRT1176713	hsa-miR-519c-5p	CLIP-seq
MIRT1176714	hsa-miR-520c-5p	CLIP-seq
MIRT1176715	hsa-miR-526a	CLIP-seq
MIRT1176716	hsa-miR-548c-3p	CLIP-seq
MIRT1176652	hsa-miR-562	CLIP-seq
MIRT1176717	hsa-miR-590-3p	CLIP-seq
MIRT1176653	hsa-miR-596	CLIP-seq
MIRT1176718	hsa-miR-603	CLIP-seq
MIRT1176719	hsa-miR-642b	CLIP-seq
MIRT1176720	hsa-miR-875-3p	CLIP-seq
MIRT1176721	hsa-miR-890	CLIP-seq
MIRT1176722	hsa-miR-9	CLIP-seq
MIRT1176723	hsa-miR-92a	CLIP-seq
MIRT1176724	hsa-miR-92b	CLIP-seq
MIRT1176725	hsa-miR-944	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT2051184	hsa-miR-4659a-3p	CLIP-seq
MIRT2051185	hsa-miR-4659b-3p	CLIP-seq
MIRT2280304	hsa-miR-4708-5p	CLIP-seq
MIRT1176654	hsa-miR-105	CLIP-seq
MIRT2280305	hsa-miR-128	CLIP-seq
MIRT2280306	hsa-miR-27a	CLIP-seq
MIRT2280307	hsa-miR-27b	CLIP-seq
MIRT2280308	hsa-miR-297	CLIP-seq
MIRT2280309	hsa-miR-3612	CLIP-seq
MIRT2280310	hsa-miR-3614-3p	CLIP-seq
MIRT2280311	hsa-miR-3675-3p	CLIP-seq
MIRT2280312	hsa-miR-3913-3p	CLIP-seq
MIRT2280313	hsa-miR-4279	CLIP-seq
MIRT1176691	hsa-miR-4325	CLIP-seq
MIRT2280314	hsa-miR-4443	CLIP-seq
MIRT2280315	hsa-miR-4635	CLIP-seq
MIRT2280316	hsa-miR-4691-5p	CLIP-seq
MIRT2280317	hsa-miR-4742-3p	CLIP-seq
MIRT1176649	hsa-miR-4795-3p	CLIP-seq
MIRT2280318	hsa-miR-4796-5p	CLIP-seq
MIRT2280319	hsa-miR-489	CLIP-seq
MIRT2280320	hsa-miR-499-3p	CLIP-seq
MIRT2280321	hsa-miR-499a-3p	CLIP-seq
MIRT2280322	hsa-miR-567	CLIP-seq
MIRT2280323	hsa-miR-605	CLIP-seq
MIRT2280324	hsa-miR-650	CLIP-seq
MIRT2280325	hsa-miR-654-3p	CLIP-seq
MIRT2280326	hsa-miR-659	CLIP-seq
MIRT2578754	hsa-miR-1207-5p	CLIP-seq
MIRT2578755	hsa-miR-1225-3p	CLIP-seq
MIRT2578756	hsa-miR-1233	CLIP-seq
MIRT2578757	hsa-miR-1257	CLIP-seq
MIRT2578758	hsa-miR-1265	CLIP-seq
MIRT2578759	hsa-miR-1275	CLIP-seq
MIRT2578760	hsa-miR-1285	CLIP-seq
MIRT2578761	hsa-miR-129-3p	CLIP-seq
MIRT2578762	hsa-miR-1302	CLIP-seq
MIRT1176657	hsa-miR-1343	CLIP-seq
MIRT1176658	hsa-miR-137	CLIP-seq
MIRT1176662	hsa-miR-223	CLIP-seq
MIRT1176664	hsa-miR-25	CLIP-seq
MIRT2578763	hsa-miR-296-3p	CLIP-seq
MIRT1176665	hsa-miR-3074-5p	CLIP-seq
MIRT2578764	hsa-miR-3122	CLIP-seq
MIRT1176668	hsa-miR-3124-3p	CLIP-seq
MIRT2578765	hsa-miR-3187-5p	CLIP-seq
MIRT2578766	hsa-miR-3199	CLIP-seq
MIRT1176672	hsa-miR-32	CLIP-seq
MIRT1176676	hsa-miR-33a	CLIP-seq
MIRT1176677	hsa-miR-33b	CLIP-seq
MIRT2578767	hsa-miR-3605-5p	CLIP-seq
MIRT2280309	hsa-miR-3612	CLIP-seq
MIRT1176678	hsa-miR-3613-3p	CLIP-seq
MIRT2578768	hsa-miR-361-3p	CLIP-seq
MIRT1176680	hsa-miR-363	CLIP-seq
MIRT2578769	hsa-miR-3655	CLIP-seq
MIRT2578770	hsa-miR-3659	CLIP-seq
MIRT1176684	hsa-miR-367	CLIP-seq
MIRT2578771	hsa-miR-3679-3p	CLIP-seq
MIRT2578772	hsa-miR-3690	CLIP-seq
MIRT2578773	hsa-miR-376a	CLIP-seq
MIRT2578774	hsa-miR-376b	CLIP-seq
MIRT2578775	hsa-miR-3909	CLIP-seq
MIRT2578776	hsa-miR-3913-5p	CLIP-seq
MIRT2578777	hsa-miR-3960	CLIP-seq
MIRT2578778	hsa-miR-409-3p	CLIP-seq
MIRT2578779	hsa-miR-4254	CLIP-seq
MIRT1176690	hsa-miR-4277	CLIP-seq
MIRT2280313	hsa-miR-4279	CLIP-seq
MIRT2578780	hsa-miR-4298	CLIP-seq
MIRT2578781	hsa-miR-432	CLIP-seq
MIRT2578782	hsa-miR-4320	CLIP-seq
MIRT2578783	hsa-miR-4425	CLIP-seq
MIRT2578784	hsa-miR-4428	CLIP-seq
MIRT2280314	hsa-miR-4443	CLIP-seq
MIRT2578785	hsa-miR-4446-5p	CLIP-seq
MIRT2578786	hsa-miR-4525	CLIP-seq
MIRT2578787	hsa-miR-4639-5p	CLIP-seq
MIRT1176695	hsa-miR-4652-3p	CLIP-seq
MIRT2578788	hsa-miR-4658	CLIP-seq
MIRT2051184	hsa-miR-4659a-3p	CLIP-seq
MIRT2051185	hsa-miR-4659b-3p	CLIP-seq
MIRT2578789	hsa-miR-4665-5p	CLIP-seq
MIRT2578790	hsa-miR-4677-3p	CLIP-seq
MIRT2578791	hsa-miR-4679	CLIP-seq
MIRT2280316	hsa-miR-4691-5p	CLIP-seq
MIRT2578792	hsa-miR-4723-5p	CLIP-seq
MIRT2280317	hsa-miR-4742-3p	CLIP-seq
MIRT2578793	hsa-miR-4763-3p	CLIP-seq
MIRT1176702	hsa-miR-4777-5p	CLIP-seq
MIRT2578794	hsa-miR-4778-3p	CLIP-seq
MIRT2578795	hsa-miR-515-5p	CLIP-seq
MIRT1176711	hsa-miR-518d-5p	CLIP-seq
MIRT1176712	hsa-miR-519b-5p	CLIP-seq
MIRT1176713	hsa-miR-519c-5p	CLIP-seq
MIRT1176714	hsa-miR-520c-5p	CLIP-seq
MIRT1176715	hsa-miR-526a	CLIP-seq
MIRT2578796	hsa-miR-548g	CLIP-seq
MIRT2578797	hsa-miR-574-5p	CLIP-seq
MIRT2578798	hsa-miR-612	CLIP-seq
MIRT2578799	hsa-miR-625	CLIP-seq
MIRT2280324	hsa-miR-650	CLIP-seq
MIRT2578800	hsa-miR-658	CLIP-seq
MIRT2280326	hsa-miR-659	CLIP-seq
MIRT2578801	hsa-miR-676	CLIP-seq
MIRT1176723	hsa-miR-92a	CLIP-seq
MIRT1176724	hsa-miR-92b	CLIP-seq
MIRT1176725	hsa-miR-944	CLIP-seq
MIRT2578801	hsa-miR-676	CLIP-seq
MIRT2578754	hsa-miR-1207-5p	CLIP-seq
MIRT2578755	hsa-miR-1225-3p	CLIP-seq
MIRT2578756	hsa-miR-1233	CLIP-seq
MIRT2578757	hsa-miR-1257	CLIP-seq
MIRT2578758	hsa-miR-1265	CLIP-seq
MIRT2578759	hsa-miR-1275	CLIP-seq
MIRT2578760	hsa-miR-1285	CLIP-seq
MIRT2578761	hsa-miR-129-3p	CLIP-seq
MIRT2578762	hsa-miR-1302	CLIP-seq
MIRT1176657	hsa-miR-1343	CLIP-seq
MIRT1176658	hsa-miR-137	CLIP-seq
MIRT2685919	hsa-miR-205	CLIP-seq
MIRT1176664	hsa-miR-25	CLIP-seq
MIRT2578763	hsa-miR-296-3p	CLIP-seq
MIRT2685920	hsa-miR-299-5p	CLIP-seq
MIRT1176665	hsa-miR-3074-5p	CLIP-seq
MIRT2578764	hsa-miR-3122	CLIP-seq
MIRT1176668	hsa-miR-3124-3p	CLIP-seq
MIRT2578765	hsa-miR-3187-5p	CLIP-seq
MIRT2578766	hsa-miR-3199	CLIP-seq
MIRT1176672	hsa-miR-32	CLIP-seq
MIRT1176676	hsa-miR-33a	CLIP-seq
MIRT1176677	hsa-miR-33b	CLIP-seq
MIRT2578767	hsa-miR-3605-5p	CLIP-seq
MIRT2280309	hsa-miR-3612	CLIP-seq
MIRT1176678	hsa-miR-3613-3p	CLIP-seq
MIRT2578768	hsa-miR-361-3p	CLIP-seq
MIRT2280310	hsa-miR-3614-3p	CLIP-seq
MIRT1176680	hsa-miR-363	CLIP-seq
MIRT2578769	hsa-miR-3655	CLIP-seq
MIRT2578770	hsa-miR-3659	CLIP-seq
MIRT1176684	hsa-miR-367	CLIP-seq
MIRT2578771	hsa-miR-3679-3p	CLIP-seq
MIRT2578772	hsa-miR-3690	CLIP-seq
MIRT2578773	hsa-miR-376a	CLIP-seq
MIRT2578774	hsa-miR-376b	CLIP-seq
MIRT2578775	hsa-miR-3909	CLIP-seq
MIRT2578776	hsa-miR-3913-5p	CLIP-seq
MIRT2578777	hsa-miR-3960	CLIP-seq
MIRT2578778	hsa-miR-409-3p	CLIP-seq
MIRT2578779	hsa-miR-4254	CLIP-seq
MIRT2280313	hsa-miR-4279	CLIP-seq
MIRT2578780	hsa-miR-4298	CLIP-seq
MIRT2578781	hsa-miR-432	CLIP-seq
MIRT2578782	hsa-miR-4320	CLIP-seq
MIRT2578783	hsa-miR-4425	CLIP-seq
MIRT2578784	hsa-miR-4428	CLIP-seq
MIRT2280314	hsa-miR-4443	CLIP-seq
MIRT2578785	hsa-miR-4446-5p	CLIP-seq
MIRT2578786	hsa-miR-4525	CLIP-seq
MIRT2578787	hsa-miR-4639-5p	CLIP-seq
MIRT1176695	hsa-miR-4652-3p	CLIP-seq
MIRT2578788	hsa-miR-4658	CLIP-seq
MIRT2051184	hsa-miR-4659a-3p	CLIP-seq
MIRT2051185	hsa-miR-4659b-3p	CLIP-seq
MIRT2578789	hsa-miR-4665-5p	CLIP-seq
MIRT2578790	hsa-miR-4677-3p	CLIP-seq
MIRT2578791	hsa-miR-4679	CLIP-seq
MIRT2280316	hsa-miR-4691-5p	CLIP-seq
MIRT2578792	hsa-miR-4723-5p	CLIP-seq
MIRT2280317	hsa-miR-4742-3p	CLIP-seq
MIRT2578793	hsa-miR-4763-3p	CLIP-seq
MIRT2578794	hsa-miR-4778-3p	CLIP-seq
MIRT2578795	hsa-miR-515-5p	CLIP-seq
MIRT2578796	hsa-miR-548g	CLIP-seq
MIRT2578797	hsa-miR-574-5p	CLIP-seq
MIRT2280323	hsa-miR-605	CLIP-seq
MIRT2578798	hsa-miR-612	CLIP-seq
MIRT2578799	hsa-miR-625	CLIP-seq
MIRT2280324	hsa-miR-650	CLIP-seq
MIRT2578800	hsa-miR-658	CLIP-seq
MIRT2280326	hsa-miR-659	CLIP-seq
MIRT2578801	hsa-miR-676	CLIP-seq
MIRT1176723	hsa-miR-92a	CLIP-seq
MIRT1176724	hsa-miR-92b	CLIP-seq
MIRT1176725	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000435	Process	Positive regulation of transcription from RNA polymerase II promoter by galactose	IDA	10207113
GO:0000785	Component	Chromatin	IDA	15831516, 17363140
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0002155	Process	Regulation of thyroid hormone receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	10207113, 15919756, 17363140
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	NAS	15774904
GO:0004402	Function	Histone acetyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	9556555, 10207113, 11682626, 12039952, 12403843, 12578355, 12917342, 14684751, 14698205, 15367689, 15641800, 16282588, 16456540, 16606617, 16957778, 17254542, 17363140, 17476305, 17627277, 17641689, 17673910, 18391212, 19039327, 19786558, 20203100, 20543827, 20682316, 21454491, 2147
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	IPI	12909012, 20543827, 20682316
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007595	Process	Lactation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016922	Function	Nuclear receptor binding	IBA
GO:0016922	Function	Nuclear receptor binding	IDA	10207113
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	17363140, 18798693
GO:0021549	Process	Cerebellum development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021854	Process	Hypothalamus development	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	IPI	18563714
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	7481822
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0032991	Component	Protein-containing complex	IMP	15641800
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	NAS	16373399
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	16373399
GO:0042974	Function	Nuclear retinoic acid receptor binding	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0044849	Process	Estrous cycle	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11891224
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15367689
GO:0045925	Process	Positive regulation of female receptivity	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9223431, 15919756, 16373399
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	12909012, 15774904
GO:0046965	Function	Nuclear retinoid X receptor binding	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050847	Process	Progesterone receptor signaling pathway	IDA	10757795
GO:0060179	Process	Male mating behavior	IEA
GO:0060713	Process	Labyrinthine layer morphogenesis	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	16373399
GO:1900076	Process	Regulation of cellular response to insulin stimulus	NAS	16373399
GO:1904017	Process	Cellular response to Thyroglobulin triiodothyronine	IEA
GO:1904179	Process	Positive regulation of adipose tissue development	NAS	16373399

Other IDs

• MIM: 602691
• HGNC: 7668
• e!Ensembl: ENSG00000084676

Protein

• UniProt ID: Q15788
• Protein name: Nuclear receptor coactivator 1 (NCoA-1) (EC 2.3.1.48) (Class E basic helix-loop-helix protein 74) (bHLHe74) (Protein Hin-2) (RIP160) (Renal carcinoma antigen NY-REN-52) (Steroid receptor coactivator 1) (SRC-1)
• Protein function: Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER),
• PDB: 1FM6, 1FM9, 1K4W, 1K74, 1K7L, 1KV6, 1N4H, 1NQ7, 1NRL, 1P8D, 1PZL, 1RDT, 1TFC, 1U3R, 1U3S, 1X76, 1X78, 1X7B, 1X7J, 1XIU, 1XV9, 1XVP, 1YY4, 1YYE, 1ZAF, 2A3I, 2C52, 2FVJ, 2GTK, 2HBH, 2HC4, 2HCD, 2HFP, 2NPA, 2NV7, 2P54, 2PRG, 3BEJ, 3BQD, 3CTB, 3CWD, 3DCT, 3DCU, 3DR1, 3ET1, 3ET3, 3FEI, 3FEJ, 3FUR, 3FXV, 3G8I
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	26 → 81	Helix-loop-helix DNA-binding domain	Domain
  PF00989	PAS	112 → 185	PAS fold	Domain
  PF14598	PAS_11	259 → 370		Domain
  PF16665	NCOA_u2	467 → 590		Disordered
  PF08832	SRC-1	628 → 708	Steroid receptor coactivator	Domain
  PF08815	Nuc_rec_co-act	924 → 971	Nuclear receptor coactivator	Domain
  PF07469	DUF1518	1149 → 1205	Domain of unknown function (DUF1518)	Domain
  PF07469	DUF1518	1212 → 1268	Domain of unknown function (DUF1518)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:15313887, ECO:0000269|PubMed:9427757}.
• Sequence:

  MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
  SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
  DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
  VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
  SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
  QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
  IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
  QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
  ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTS
  LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
  SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
  TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
  VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
  MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
  TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
  QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
  VQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT
  MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
  AATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
  GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN
  RNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI
  PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
  MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
  ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
  E

• Sequence length: 1441

Pathways

KEGG:

Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer

Reactome:

RORA activates gene expression
Recycling of bile acids and salts
Synthesis of bile acids and bile salts
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
Synthesis of bile acids and bile salts via 27-hydroxycholesterol
PPARA activates gene expression
Endogenous sterols
Transcriptional activation of mitochondrial biogenesis
Activation of gene expression by SREBF (SREBP)
HATs acetylate histones
Transcriptional regulation of white adipocyte differentiation
SUMOylation of transcription cofactors
Regulation of lipid metabolism by PPARalpha
Circadian Clock
Estrogen-dependent gene expression
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NCOA1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31633491		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	31633491		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27115168		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31633491		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	26371783		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16891307		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31633491		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20963570, 22142990, 22542550		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	24652666		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29227976		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27880726, 29152074, 30061836		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	27468165	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18845648		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	22174377	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14715875, 15788656, 16084947, 20003447, 20145129, 21343398, 22072566, 22419892, 24304549, 24648347, 24719557, 24769444, 25284587, 26082485, 26202054, 26287601, 29367763, 30532986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20332317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29058716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10688660, 15477868, 19755984, 20003447, 24304549, 24719557, 26621841, 27107013, 28973975	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24705462	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	16894533		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	34067464	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28060733	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30405769		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29452160		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28740336		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32764874	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29805604		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	24652666		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	24652666	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21654685		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31668381		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31668381		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33083497	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32922187	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	35137184	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27115168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	19953635		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	35137184	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	14601091, 19439667		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	14601091		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	14601091	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	14601091	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	25297546, 29636364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30270520	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30270520	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20124487		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	31452712		★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	11061510, 24550004, 9804773		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27560795	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30532986		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26516695		★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	19423651	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23936147	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30089865		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27560795	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33574497	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26082485, 28060733, 30405769		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35137184	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26082485		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29717026		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28264017		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	26244872		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14715875, 15788656, 16084947, 20003447, 20145129, 21343398, 22072566, 22419892, 24304549, 24648347, 24719557, 24769444, 25284587, 26082485, 26287601, 29367763, 30532986, 9252329		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19439667		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30405769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12237244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15663989, 16140968, 16894533, 24705462, 26082485, 26201947, 27255895, 29786798, 30532986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31452712		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29717026		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11489729, 16140968, 22419892, 23559371, 24304549, 26202054, 27842582, 28611048, 29367763, 29567811, 30270520, 3070044		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11108862, 21343398, 26287601		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14715875		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20332317		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	1697409, 21654685		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	BEFREE	29524638		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	24652666		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24652666	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28264017		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28264017	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30973923		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14715875, 16140968, 16762838, 21080969, 22072566, 22419892, 22695118, 26082485, 26287601, 28060733, 29717026, 3029760, 30973923, 31464709, 31633491		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29077881		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35137184	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29567811		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	22174377, 28286232		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	40603950	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31464709, 38000680	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31633491		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15663989, 16140968, 16894533, 24705462, 26082485, 26201947, 27255895, 29786798, 30532986		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12163482, 24705462	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12237244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16894533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40655182	Inhibit	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	14535629		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15313887		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	15313887		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19953635, 32187044	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	26371783, 36232302	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14535629		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33574497	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	17400812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30270520		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26516695		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31452712		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29717026		★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	35137184	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29717026		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18845648	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20124487		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	31464709, 38000680	Associate	★☆☆☆☆ Found in Text Mining only