RUNX3 (RUNX family transcription factor 3)

Gene

• Entrez ID: 864
• Gene name: RUNX family transcription factor 3
• Gene symbol: RUNX3
• Synonyms (NCBI Gene): AML2, CBFA3, PEBP2aC
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5`-PYGPYGGT-3` found in a number of enhancers and promoters, and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000038	hsa-miR-532-5p	Review	20026422
MIRT003316	hsa-miR-130b-3p	qRT-PCR, Western blot	20176475
MIRT000038	hsa-miR-532-5p	Flow, qRT-PCR	19336521
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, Western blot	22846564
MIRT007295	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23338485
MIRT019365	hsa-miR-148b-3p	Microarray	17612493
MIRT003316	hsa-miR-130b-3p	Sequencing	20371350
MIRT028012	hsa-miR-93-5p	Sequencing	20371350
MIRT053518	hsa-miR-148a-3p	qRT-PCR, Western blot	23549984
MIRT053564	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23932924
MIRT053564	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23932924
MIRT437468	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23912048
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay	23874686
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay	23874686
MIRT568953	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT568954	hsa-miR-637	PAR-CLIP	20371350
MIRT568952	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT568950	hsa-miR-8085	PAR-CLIP	20371350
MIRT568949	hsa-miR-3175	PAR-CLIP	20371350
MIRT568948	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT568947	hsa-miR-5698	PAR-CLIP	20371350
MIRT568946	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT568944	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT568943	hsa-miR-4488	PAR-CLIP	20371350
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	20371350
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	20371350
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	20371350
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	20371350
MIRT568935	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	20371350
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT565941	hsa-miR-3137	PAR-CLIP	20371350
MIRT565940	hsa-miR-20b-3p	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT565938	hsa-miR-6753-3p	PAR-CLIP	20371350
MIRT565939	hsa-miR-7107-3p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT439719	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439719	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT007055	hsa-miR-130a-3p	SNU16	26375442
MIRT731247	hsa-miR-495-3p	SNU16	26375442
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26134263
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26134263
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT731247	hsa-miR-495-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT731247	hsa-miR-495-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT000038	hsa-miR-532-5p	Luciferase reporter assay, qRT-PCR, Western blot	26515139
MIRT000038	hsa-miR-532-5p	Luciferase reporter assay, qRT-PCR, Western blot	26515139
MIRT561650	hsa-miR-20a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27748919
MIRT561650	hsa-miR-20a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27748919
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	26701625
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	26701625
MIRT568949	hsa-miR-3175	PAR-CLIP	26701625
MIRT568949	hsa-miR-3175	PAR-CLIP	26701625
MIRT568943	hsa-miR-4488	PAR-CLIP	26701625
MIRT568943	hsa-miR-4488	PAR-CLIP	26701625
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	26701625
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	26701625
MIRT568948	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT568947	hsa-miR-5698	PAR-CLIP	26701625
MIRT568935	hsa-miR-615-5p	PAR-CLIP	26701625
MIRT568935	hsa-miR-615-5p	PAR-CLIP	26701625
MIRT568954	hsa-miR-637	PAR-CLIP	26701625
MIRT568954	hsa-miR-637	PAR-CLIP	26701625
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	26701625
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	26701625
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	26701625
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	26701625
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	26701625
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	26701625
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT568946	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT568944	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT568950	hsa-miR-8085	PAR-CLIP	26701625
MIRT568950	hsa-miR-8085	PAR-CLIP	26701625
MIRT568953	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT568954	hsa-miR-637	PAR-CLIP	20371350
MIRT568952	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT568950	hsa-miR-8085	PAR-CLIP	20371350
MIRT568949	hsa-miR-3175	PAR-CLIP	20371350
MIRT568948	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT568947	hsa-miR-5698	PAR-CLIP	20371350
MIRT568946	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT568944	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT568943	hsa-miR-4488	PAR-CLIP	20371350
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	20371350
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	20371350
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	20371350
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	20371350
MIRT568935	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	20371350
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT565941	hsa-miR-3137	PAR-CLIP	20371350
MIRT565940	hsa-miR-20b-3p	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT565938	hsa-miR-6753-3p	PAR-CLIP	20371350
MIRT565939	hsa-miR-7107-3p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT1323020	hsa-miR-1265	CLIP-seq
MIRT1323021	hsa-miR-1587	CLIP-seq
MIRT1323022	hsa-miR-214	CLIP-seq
MIRT1323023	hsa-miR-320e	CLIP-seq
MIRT1323024	hsa-miR-3619-5p	CLIP-seq
MIRT1323025	hsa-miR-378g	CLIP-seq
MIRT1323026	hsa-miR-4271	CLIP-seq
MIRT1323027	hsa-miR-4459	CLIP-seq
MIRT1323028	hsa-miR-4474-3p	CLIP-seq
MIRT1323029	hsa-miR-4492	CLIP-seq
MIRT1323030	hsa-miR-4498	CLIP-seq
MIRT1323031	hsa-miR-4505	CLIP-seq
MIRT1323032	hsa-miR-4656	CLIP-seq
MIRT1323033	hsa-miR-4661-3p	CLIP-seq
MIRT1323034	hsa-miR-4675	CLIP-seq
MIRT1323035	hsa-miR-4722-5p	CLIP-seq
MIRT1323036	hsa-miR-4725-3p	CLIP-seq
MIRT1323037	hsa-miR-4741	CLIP-seq
MIRT1323038	hsa-miR-4764-5p	CLIP-seq
MIRT1323039	hsa-miR-4779	CLIP-seq
MIRT1323040	hsa-miR-604	CLIP-seq
MIRT1323041	hsa-miR-624	CLIP-seq
MIRT1323042	hsa-miR-647	CLIP-seq
MIRT1323043	hsa-miR-761	CLIP-seq
MIRT1323044	hsa-miR-762	CLIP-seq
MIRT1323045	hsa-miR-185	CLIP-seq
MIRT1323046	hsa-miR-3150b-3p	CLIP-seq
MIRT1323047	hsa-miR-4306	CLIP-seq
MIRT1323048	hsa-miR-4644	CLIP-seq
MIRT1323049	hsa-miR-4708-5p	CLIP-seq
MIRT1323050	hsa-miR-4784	CLIP-seq
MIRT1323041	hsa-miR-624	CLIP-seq
MIRT2095860	hsa-miR-4302	CLIP-seq
MIRT2320255	hsa-miR-1224-5p	CLIP-seq
MIRT2320256	hsa-miR-1304	CLIP-seq
MIRT2320257	hsa-miR-1915	CLIP-seq
MIRT1323046	hsa-miR-3150b-3p	CLIP-seq
MIRT2320258	hsa-miR-3915	CLIP-seq
MIRT1323027	hsa-miR-4459	CLIP-seq
MIRT2320259	hsa-miR-4689	CLIP-seq
MIRT2320260	hsa-miR-4695-5p	CLIP-seq
MIRT2320261	hsa-miR-4722-3p	CLIP-seq
MIRT1323050	hsa-miR-4784	CLIP-seq
MIRT2320262	hsa-miR-495	CLIP-seq
MIRT2320263	hsa-miR-545	CLIP-seq
MIRT2320264	hsa-miR-665	CLIP-seq
MIRT2393965	hsa-miR-1293	CLIP-seq
MIRT2393966	hsa-miR-4483	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CBFB	Unknown	24648201
DNMT1	Unknown	22274925
EHMT2	Activation	18850007
EZH2	Repression	18430739;20631058;22222375
HDAC1	Activation	18850007
HDAC1	Repression	18850007
HDAC1	Unknown	18430739;22274925

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001222	Function	Transcription corepressor binding	IPI	9751710
GO:0001503	Process	Ossification	IBA
GO:0002062	Process	Chondrocyte differentiation	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7607690
GO:0005515	Function	Protein binding	IPI	9751710, 17377532, 18772112, 20100835, 20599712, 24229708, 32296183, 33961781, 38424632
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	7835892
GO:0005634	Component	Nucleus	IDA	20100835, 20599712
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	20100835, 20599712
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	7622058
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006468	Process	Protein phosphorylation	IDA	20100835
GO:0016513	Component	Core-binding factor complex	TAS	18258917
GO:0030097	Process	Hemopoiesis	IBA
GO:0030182	Process	Neuron differentiation	IBA
GO:0043371	Process	Negative regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043378	Process	Positive regulation of CD8-positive, alpha-beta T cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045786	Process	Negative regulation of cell cycle	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	20599712
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0048935	Process	Peripheral nervous system neuron development	TAS	20096094
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0071559	Process	Response to transforming growth factor beta	IDA	20599712
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 600210
• HGNC: 10473
• e!Ensembl: ENSG00000020633

Protein

• UniProt ID: Q13761
• Protein name: Runt-related transcription factor 3 (Acute myeloid leukemia 2 protein) (Core-binding factor subunit alpha-3) (CBF-alpha-3) (Oncogene AML-2) (Polyomavirus enhancer-binding protein 2 alpha C subunit) (PEA2-alpha C) (PEBP2-alpha C) (SL3-3 enhancer factor 1 a
• Protein function: Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their r
• PDB: 5W69
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00853	Runt	55 → 184	Runt domain	Domain
  PF08504	RunxI	316 → 415	Runx inhibition domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in gastric cancer tissues (at protein level). {ECO:0000269|PubMed:20599712}.
• Sequence:

  MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
  DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
  LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
  RRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
  PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
  SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
  LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY

• Sequence length: 415

Pathways

KEGG:

Th1 and Th2 cell differentiation
Epstein-Barr virus infection

Reactome:

Binding of TCF/LEF:CTNNB1 to target gene promoters
RUNX3 regulates CDKN1A transcription
RUNX3 regulates NOTCH signaling
Regulation of RUNX3 expression and activity
RUNX3 Regulates Immune Response and Cell Migration
RUNX3 regulates WNT signaling
RUNX3 regulates YAP1-mediated transcription
RUNX3 regulates RUNX1-mediated transcription
RUNX3 regulates p14-ARF
RUNX3 regulates BCL2L11 (BIM) transcription

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER'S DISEASE NEUROPATHOLOGIC CHANGE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRO-ENTEROPANCREATIC NEUROENDOCRINE TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	8710369		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25612675		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	18206229		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	18206229		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31298391		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12841866, 16328045, 17606310, 19764999, 22729835, 24229708, 26082616, 26862903, 29100342		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	25229459, 31831860		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	24403453		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20228843, 21508367, 22729835, 23892093, 24229708, 26239696		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	24938604		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	18410404, 21105967, 21658745		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	14968123, 18772112, 24229708, 24622886		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18772112		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19174785, 19470943, 22936446		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27184221		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27748919		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	18410404, 21105967, 21567090, 25551195		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37253165	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21743469, 23401011, 23637848, 25494292, 26452539, 29480940, 30687330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	CTD_human_DG	21743469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	18410404, 21105967, 21567090, 25551195		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	19596937		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	25540605	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23401011	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33482886	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	23401011		★☆☆☆☆ Found in Text Mining only
Asphyxia	Asphyxia	Pubtator	30896667	Associate	★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	30896667		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23346934, 28804539, 28962214, 30218658, 31622282		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	25769910, 27902892, 31622282, 34719421, 39380119	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	29785011, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	31467531		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	25967717	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23143594		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15824739, 25229459, 31831860		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	15824739		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	18831746	Associate	★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	16767156		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	17470130, 21205092		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	15471559, 17470130, 21205092	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16230397, 18639281, 18676844, 18684727, 21956756, 22311819, 23886181		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18639281, 18676844, 18684727		★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	39614348	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	22076387		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23934435		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16818622, 17171680, 17923751, 18256927, 18339859, 18580070, 20955380, 21612813, 22076387, 22275124, 22580604, 23045283, 23851507, 24036662, 25525332, 25636590, 27825140, 29282690, 29581836, 29749447, 30133331, 30570350		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14968123, 17923751, 18339859, 18628296, 22037257, 22580604, 24002642, 24036662, 26657794, 27023391, 29127590, 29749447, 32307917, 32771023, 35906698, 36499753, 37420018	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22580604	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	31622282		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	31622282	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19403666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14760761, 14968123, 15819721, 17923751, 21205319, 22158627, 22576578, 23269881, 23704974, 24312710, 24622886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21105967, 21205092, 24447505, 25008775, 26375442	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14743205, 14968123, 15051926, 15471559, 16091737, 17914577, 18572225, 19336521, 21819494, 23073987, 23457532, 28765934		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	18410404, 25551195	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21105967	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	30178853	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	35906698	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14760761, 14968123, 21205319, 22180715, 22488108, 26225676, 26985715, 29019900, 31503422, 35143426, 35909886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17094378, 22296371	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	21105967	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18676844, 18684727, 21956756, 22311819, 23886181		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	23912048, 28795320		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14715269, 16142337, 16328045, 20228843, 20801098, 22729835, 23670097, 26239696		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25854397, 33482905	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28882948	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23457532	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30272265, 38172737	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34294773	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35864175	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21612813, 21623876		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18937968, 19645591, 21612813, 26175272, 26186909, 27048832		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20955380, 27825140		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28534977		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	20190752	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	18663147		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27748919		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22446083, 27009864	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	19596937		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	23666463		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	25066130		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22296371		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	15514019		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26862732, 36140736	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15386381, 18949360, 19571605, 24403453, 25879218		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	18949360, 20442291, 20682997		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18949360		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15273736, 15386381, 16080503, 16475679, 17270239, 17339237, 18084250, 18551179, 19174785, 19223906, 20442291, 20631058, 20682997, 21088106, 21109941, 21625944, 22274925, 22901464, 23104301, 24042352, 24403453, 25973084, 26634516, 27633042, 28061442, 28107874, 28498402, 28940471, 29333422, 29849790, 30362160, 30692634, 30763934, 30944663, 31278361, 31524773		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14968123, 16080503, 16475679, 17474983, 18834226, 19002263, 19223906, 20631058, 21088106, 22274925, 23104301, 25167802, 25541970, 25879218, 26634516, 26862732, 28061442, 28469732, 29930328, 31179817, 33401247, 34957998, 35072538	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15273736, 16080503, 19174785		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20682997		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24622886	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29359783		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23457532, 29254144, 30272265, 30877466		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26520896		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	34719421	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18668679, 20887385		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19336521		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23874686	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24750349		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35937821	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27184221		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	22275124		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	22275124		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	36678166	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	14968123, 18572225, 29693143		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	14968123, 29693143, 34799276	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18572225		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	25333219		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25333219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	34799276	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18937968, 19645591, 26175272, 26186909, 27048832		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	25641675, 28299669		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17384682, 18288406, 24175838, 25229459, 28468586		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15824739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17384682, 18288406, 25229459, 28468586		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	18058463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26225648, 28468586, 33960364	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22171134	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25514805, 35913453	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32323849	Inhibit	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24812032		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	15824739, 18831746, 25229459		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30110632		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30110632		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30951700		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	18580070		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	14968123, 25967717	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	22576578, 27196446	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	19728008, 22576578, 27196446		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	CTD_human_DG	29915428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	18551179		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	28119527	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16909125		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	22076387		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16909125, 23934435, 25467143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	16909125		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	24056404, 30982493	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	16909125, 23934435, 25467143, 30982493		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16909125		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21922326	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25563195	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29340016, 29916101		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	15574200, 31311113		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20714105	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21268058, 21612813, 21819494		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	19521519	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26225676	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18339859	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	29316655, 31610747		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	26093269		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16818622		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15514019, 18668679, 20887385		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37988718	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	27067780	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	24312710		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	19827872, 27009864		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20955380, 27825140		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	21803306		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	21625944		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37965330	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	33933144	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30119977		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26853927, 27859417		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17716379	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25066130, 25612675, 26624983, 30719500		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15251987, 15778373, 18663147, 19543515, 19666867, 20795789, 24164743, 31085557, 32741803, 35490198	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15510208, 18360721, 18663147, 24402164, 25612675, 27530922, 28579269, 28958164, 29501566, 30719500, 31002772, 31085557, 7769841, 8086341		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	18206229		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28030842, 30535462		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14760761, 14968123, 15780064, 16155404, 17094378, 19800882, 21205319, 21328447, 21600201, 21637926, 22296371, 22488108, 25037468, 25061743, 25664646, 26225676, 26392314, 26985715, 27271356, 27420934, 27748919, 28458013, 28977878, 29019900, 30520539, 31503422, 31790342		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16155404		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28458013		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22296371, 31790342		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14715269, 16142337, 16328045, 17606310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	16603640, 31122259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	21742797, 22729835	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34084162	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22296371	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24938604, 32323849	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21504712		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21504712	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	39843653	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	27377697, 31139323		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21268058, 21612813, 21819494		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14968123, 16818622, 17171680, 17923751, 18256927, 18339859, 18580070, 20100835, 21612813, 22076387, 22275124, 22580604, 23045283, 23851507, 24036662, 25525332, 25636590, 27825140, 29282690, 29581836, 29749447, 30133331, 30570350		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29693143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17384682, 18288406, 25229459, 28468586		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	18058463		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	18058463, 21465522		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29651226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	14968123		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27748919, 29019900, 29636640		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14715269, 14968123, 16142337, 16328045, 17606310, 20228843, 20801098, 22729835, 23670097, 26239696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28030842, 30535462		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15386381, 18937968, 19645591, 21612813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14743205, 18475302, 23664167, 24938604, 26046433, 28299667, 28882948, 31609478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14743506, 14968123, 19470943, 22810147, 24475196, 30195463, 31485638		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	21623876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11955451, 12086855, 12776174, 12824905, 14968123, 15156190, 15386419, 15685235, 15756676, 16135801, 16140942, 16166423, 16367921, 16627973, 16917803, 16964375, 17085650, 17591800, 18288406, 18850007, 19196394, 19290488, 19552756, 19596937, 19728008, 20021617, 20176475, 20300977, 20492341, 21128246, 21135153, 21302620, 21328447, 21523770, 21867527, 22231444, 22576578, 22936446, 23049225, 23230322, 23549984, 23774402, 24447545, 24636883, 25088199, 25641675, 25693942, 26134263, 26515139, 27566570, 27664488, 27721253, 28529617, 28828318, 29054094, 29417297, 29545901, 29578091, 29742512		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23269881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	21819494		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18676844, 18684727, 21956756, 22311819, 23724145, 23886181		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12824905, 12841866, 14743205, 14968123, 15780064, 16984612, 17914577, 18097595, 18475302, 18639281, 18684727, 18772112, 18850007, 19223906, 19290488, 19414342, 19682550, 20348954, 20682997, 20955380, 21205092, 21205319, 21268058, 21302620, 21465522, 21523770, 21637926, 21867527, 22158627, 22274925, 22275124, 23504001, 23664167, 25088199, 25270738, 25641675, 25811792, 26004068, 26239696, 26657794, 26708741, 27048832, 27377697, 27566570, 27633042, 28299666, 28299667, 28299669, 28621161, 28958164, 29074538, 29211713, 29305464, 29429451, 29545901, 29749447, 29805611, 30535344, 30719500, 30763934, 31085557, 31436249, 31467531, 31831860		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14968123, 15386381, 18949360, 19571605, 24403453, 25879218		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16818622, 17923751, 18256927, 18580070		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18339859, 30133331		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	15386381		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19336521, 21623876, 26621846, 28699302, 30961683		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19336521, 26621846	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21656750, 21835883	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19336521	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	25648363		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25648363	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30535462	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	21105967		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28958164		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35626671	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	38009648	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19543515		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25066130		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31625414		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17201146		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17201146	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	24056404	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12086855, 12875960, 14715269, 14743205, 15051926, 15156173, 15156190, 15386381, 15471559, 15756676, 15780064, 16091737, 16135801, 16140942, 16142337, 16230397, 16234815, 16325352, 16328045, 16367921, 16586533, 16627973, 16818622, 16909125, 16917803, 17085650, 17094378, 17171680, 17201146, 17270239, 17384682, 17470130, 17591929, 17914577, 17923751, 17956589, 18037406, 18058463, 18097595, 18288406, 18339859, 18410404, 18475302, 18500170, 18551179, 18572225, 18580070, 18684727, 18772112, 18850007, 18937968, 18949360, 19196394, 19223906, 19336521, 19596937, 19645591, 19682550, 19706291, 19808967, 19827872, 19830829, 20100835, 20176475, 20228843, 20300977, 20348954, 20492341, 20599712, 20631058, 20676134, 20682997, 20801098, 21105967, 21109941, 21128246, 21135153, 21205092, 21205319, 21268058, 21302620, 21328447, 21374661, 21465522, 21504712, 21523770, 21612813, 21623876, 21637926, 21640801, 21819494, 21867527, 21896084, 21956756, 22076387, 22274925, 22275124, 22311819, 22488108, 22576578, 22580604, 22899304, 22901464, 22936053, 23045283, 23104301, 23180629, 23225212, 23230322, 23457532, 23485510, 23504001, 23549984, 23664167, 23666463, 23704974, 23724145, 23800731, 23851507, 23892093, 23912048, 24042352, 24100442, 24447505, 24447545, 24475196, 24641363, 24812032, 25008775, 25037468, 25061743, 25088199, 25229459, 25270738, 25428380, 25525332, 25563195, 25636590, 25641675, 25648363, 25664646, 25693942, 25879218, 26004068, 26046131, 26082616, 26134263, 26239696, 26364597, 26392314, 26417932, 26484416, 26621846, 26657794, 26708741, 26898755, 26985715, 27377697, 27566570, 27633042, 27721253, 27748919, 27859417, 27990641, 28011426, 28030842, 28107874, 28299666, 28299667, 28299669, 28299672, 28468586, 28699302, 28765934, 28795320, 28882948, 28893223, 28977878, 29054094, 29074538, 29201108, 29211713, 29254144, 29282690, 29333422, 29342962, 29417297, 29429451, 29547969, 29578091, 29651226, 29742512, 29805611, 29916101, 30110632, 30535462, 30553475, 30692634, 30763934, 30961683, 31122259, 31278361, 31311113, 31467531, 31790342		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29845298		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11319804, 21640801, 23851507		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31603252		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12841866, 16328045, 17606310, 26082616, 26239696, 28656235, 29545901, 30816536		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30951700		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	18256927, 20955380, 27825140, 28893223		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30133331		★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 2A	Osteogenesis imperfecta	Pubtator	26225648	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	25605327		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	25605327		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	18937968		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25298284, 34799276	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18937968, 19645591, 21612813, 23504001		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18937968		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34799276	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14743205, 18475302, 23664167, 24938604, 26046433, 28299667, 28882948, 31609478		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26004068, 26045017, 28299667		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18475302		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26046433		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14990603, 23664167, 24938604, 28882948, 31609478	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18475302	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	25066130		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23269881		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28299667		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	15685235		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	19174785		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19470943, 22810147, 24475196, 30195463, 31485638		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14968123, 19470943, 37582751, 38007527	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	CTD_human_DG	23143594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	23401011	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	26045321, 27082311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	23401011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28699703		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	23143594		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	25541970, 31452807		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29651226		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23457532, 29254144		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15685235	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28901461		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	21105967	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	24812032	Associate	★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	24812288	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	27377697, 31139323		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	27377697	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21623876		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16328045		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	23401011		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	21743469, 23401011, 23637848, 26452539, 32355155, 33369221	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12841866, 16328045, 17384682, 17606310, 19015875, 19764999, 21380558, 21623876, 26082616, 26862903, 28030842, 28765934, 30535462		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16582583, 18058463, 18288406, 18500170		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18058463, 18288406, 18500170, 22171134, 24641363, 25391920, 25428380, 25514805		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19521519	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30535462	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	22936053		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30535462		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11955451, 12776174, 12824905, 14968123, 15051926, 15386419, 15685235, 15756676, 16135801, 16140942, 16166423, 16367921, 16627973, 16917803, 17085650, 17591800, 17956589, 18288406, 18494051, 18850007, 19196394, 19290488, 19552756, 19596937, 19728008, 20176475, 20300977, 20492341, 21128246, 21135153, 21302620, 21328447, 21523770, 21867527, 22104201, 22231444, 22576578, 22936446, 23049225, 23230322, 23549984, 23774402, 24447545, 24636883, 25088199, 25270738, 25641675, 25693942, 26134263, 26515139, 27566570, 27664488, 27721253, 28529617, 28828318, 29054094, 29417297, 29578091, 29742512, 30553475		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	19808967	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12824905, 15386419, 16140942, 16367921, 16627973, 17591800, 18097595, 18430739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	12824905, 14968123, 16367921, 17094378, 17591800, 18430739, 19552756, 19596937, 20082478, 20100835, 21203466, 21523770, 22576578, 23049225, 23243425, 23555166, 23932924, 24312710, 24447505, 26134263, 27566570, 32762126, 38240752	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	14990603, 15685235, 16080503, 17956589, 18410404, 19552756, 20353948, 21205319, 22488108, 23549984, 23664167, 25270738, 25967717, 26289240, 26375442, 26985715, 30871613	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	16738314, 18772112, 19682550, 19706291, 20492341, 20676134, 21567391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	31126957		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28119527		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	12875960	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	19886737		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23269881	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23269881		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23269881		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23269881	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36499753	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18668679, 20160714, 20392673, 20887385, 21109941, 30473377, 30763934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	18668679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18676844, 22699781, 23724145, 23886181, 24577895	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14968123	Associate	★☆☆☆☆ Found in Text Mining only