AOC3 (amine oxidase copper containing 3)

Gene

• Entrez ID: 8639
• Gene name: Amine oxidase copper containing 3
• Gene symbol: AOC3
• Synonyms (NCBI Gene): HPAO, SSAO, VAP-1, VAP1
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes a member of the semicarbazide-sensitive amine oxidase family. Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The encoded protein is localized to the cell sur

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT562752	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT562751	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT562750	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT562749	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT562748	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT562746	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT562747	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT562745	hsa-miR-556-3p	PAR-CLIP	20371350
MIRT562744	hsa-miR-5096	PAR-CLIP	20371350
MIRT562743	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT562742	hsa-miR-1282	PAR-CLIP	20371350
MIRT451329	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451328	hsa-miR-4459	PAR-CLIP	23592263
MIRT451327	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT451326	hsa-miR-765	PAR-CLIP	23592263
MIRT451325	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT562752	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT562751	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT562750	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT562749	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT562748	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT562746	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT562747	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT562745	hsa-miR-556-3p	PAR-CLIP	20371350
MIRT562744	hsa-miR-5096	PAR-CLIP	20371350
MIRT562743	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT562742	hsa-miR-1282	PAR-CLIP	20371350
MIRT451329	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451328	hsa-miR-4459	PAR-CLIP	23592263
MIRT451327	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT451326	hsa-miR-765	PAR-CLIP	23592263
MIRT451325	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT786709	hsa-miR-1293	CLIP-seq
MIRT786710	hsa-miR-22	CLIP-seq
MIRT786711	hsa-miR-3064-5p	CLIP-seq
MIRT786712	hsa-miR-3126-5p	CLIP-seq
MIRT786713	hsa-miR-3187-3p	CLIP-seq
MIRT786714	hsa-miR-326	CLIP-seq
MIRT786715	hsa-miR-330-5p	CLIP-seq
MIRT786716	hsa-miR-361-5p	CLIP-seq
MIRT786717	hsa-miR-3652	CLIP-seq
MIRT786718	hsa-miR-3664-5p	CLIP-seq
MIRT786719	hsa-miR-3714	CLIP-seq
MIRT786720	hsa-miR-3920	CLIP-seq
MIRT786721	hsa-miR-3925-3p	CLIP-seq
MIRT786722	hsa-miR-4278	CLIP-seq
MIRT786723	hsa-miR-4430	CLIP-seq
MIRT786724	hsa-miR-4435	CLIP-seq
MIRT786725	hsa-miR-4483	CLIP-seq
MIRT786726	hsa-miR-4505	CLIP-seq
MIRT786727	hsa-miR-4519	CLIP-seq
MIRT786728	hsa-miR-4520a-3p	CLIP-seq
MIRT786729	hsa-miR-4520b-3p	CLIP-seq
MIRT786730	hsa-miR-4667-3p	CLIP-seq
MIRT786731	hsa-miR-4667-5p	CLIP-seq
MIRT786732	hsa-miR-4685-5p	CLIP-seq
MIRT786733	hsa-miR-4700-5p	CLIP-seq
MIRT786734	hsa-miR-4701-5p	CLIP-seq
MIRT786735	hsa-miR-4714-5p	CLIP-seq
MIRT786736	hsa-miR-4749-3p	CLIP-seq
MIRT786737	hsa-miR-548s	CLIP-seq
MIRT786738	hsa-miR-588	CLIP-seq
MIRT786739	hsa-miR-615-5p	CLIP-seq
MIRT786740	hsa-miR-637	CLIP-seq
MIRT786741	hsa-miR-766	CLIP-seq
MIRT786742	hsa-miR-873	CLIP-seq
MIRT786743	hsa-miR-940	CLIP-seq
MIRT786744	hsa-miR-944	CLIP-seq
MIRT1932036	hsa-miR-1255a	CLIP-seq
MIRT1932037	hsa-miR-1255b	CLIP-seq
MIRT1932038	hsa-miR-1291	CLIP-seq
MIRT1932039	hsa-miR-150	CLIP-seq
MIRT1932040	hsa-miR-1913	CLIP-seq
MIRT1932041	hsa-miR-1972	CLIP-seq
MIRT1932042	hsa-miR-3173-5p	CLIP-seq
MIRT786713	hsa-miR-3187-3p	CLIP-seq
MIRT1932043	hsa-miR-3189-5p	CLIP-seq
MIRT1932044	hsa-miR-324-3p	CLIP-seq
MIRT1932045	hsa-miR-4438	CLIP-seq
MIRT1932046	hsa-miR-4474-3p	CLIP-seq
MIRT1932047	hsa-miR-4755-3p	CLIP-seq
MIRT1932048	hsa-miR-4758-3p	CLIP-seq
MIRT1932049	hsa-miR-508-5p	CLIP-seq
MIRT786741	hsa-miR-766	CLIP-seq
MIRT1932039	hsa-miR-150	CLIP-seq
MIRT2172464	hsa-miR-3160-3p	CLIP-seq
MIRT786713	hsa-miR-3187-3p	CLIP-seq
MIRT2172465	hsa-miR-3692	CLIP-seq
MIRT786719	hsa-miR-3714	CLIP-seq
MIRT2172466	hsa-miR-4436b-5p	CLIP-seq
MIRT2172467	hsa-miR-4487	CLIP-seq
MIRT1932049	hsa-miR-508-5p	CLIP-seq
MIRT2172468	hsa-miR-558	CLIP-seq
MIRT2172469	hsa-miR-626	CLIP-seq
MIRT786741	hsa-miR-766	CLIP-seq
MIRT786742	hsa-miR-873	CLIP-seq
MIRT786743	hsa-miR-940	CLIP-seq
MIRT2475425	hsa-miR-374c	CLIP-seq
MIRT2475426	hsa-miR-4698	CLIP-seq
MIRT2475427	hsa-miR-4704-3p	CLIP-seq
MIRT2475428	hsa-miR-4717-3p	CLIP-seq
MIRT2475429	hsa-miR-655	CLIP-seq
MIRT2475425	hsa-miR-374c	CLIP-seq
MIRT2475426	hsa-miR-4698	CLIP-seq
MIRT2475427	hsa-miR-4704-3p	CLIP-seq
MIRT2475428	hsa-miR-4717-3p	CLIP-seq
MIRT2475429	hsa-miR-655	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005507	Function	Copper ion binding	IBA
GO:0005507	Function	Copper ion binding	IDA	16046623
GO:0005507	Function	Copper ion binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	16046623
GO:0005515	Function	Protein binding	IPI	23349812, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	23349812
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	23474851
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	23474851
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	23474851
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9653080
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	23349812
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9653080
GO:0007155	Process	Cell adhesion	IDA	9653080
GO:0007155	Process	Cell adhesion	IEA
GO:0008131	Function	Primary methylamine oxidase activity	IDA	23349812
GO:0008131	Function	Primary methylamine oxidase activity	IDA	9653080, 19588076, 23474851
GO:0008131	Function	Primary methylamine oxidase activity	IEA
GO:0009308	Process	Amine metabolic process	IBA
GO:0009308	Process	Amine metabolic process	IDA	9653080
GO:0009308	Process	Amine metabolic process	IEA
GO:0009986	Component	Cell surface	IDA	9653080, 23349812
GO:0016020	Component	Membrane	IDA	9653080
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16046623
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	23349812
GO:0048038	Function	Quinone binding	IDA	9653080
GO:0048038	Function	Quinone binding	IEA

Other IDs

• MIM: 603735
• HGNC: 550
• e!Ensembl: ENSG00000131471

Protein

• UniProt ID: Q16853
• Protein name: Amine oxidase [copper-containing] 3 (EC 1.4.3.21) (Amine oxidase copper-containing 3) (Copper amine oxidase) (HPAO) (Semicarbazide-sensitive amine oxidase) (SSAO) (Vascular adhesion protein 1) (VAP-1)
• Protein function: Catalyzes the oxidative deamination of primary amines to the corresponding aldehydes with the concomitant production of hydrogen peroxide and ammonia (PubMed:19588076, PubMed:24304424, PubMed:9653080). Has a preference for the primary monoamines
• PDB: 1PU4, 1US1, 2C10, 2C11, 2Y73, 2Y74, 3ALA, 4BTW, 4BTX, 4BTY, 8S1Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02727	Cu_amine_oxidN2	66 → 152	Copper amine oxidase, N2 domain	Domain
  PF02728	Cu_amine_oxidN3	169 → 269	Copper amine oxidase, N3 domain	Domain
  PF01179	Cu_amine_oxid	314 → 721	Copper amine oxidase, enzyme domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed on the high endothelial venules of peripheral lymph nodes and on hepatic endothelia. Also highly expressed in appendix, lung and small intestine. Expressed also in adipose tissue, in bone marrow, colon, heart, kidney
• Sequence:

  MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLF
  ADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPP
  AREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDID
  QMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFL
  HHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
  SLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
  YEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ
  APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFH
  PSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVW
  AEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHP
  RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDF
  SDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSA
  DSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN

• Sequence length: 763

Pathways

KEGG:

Glycine, serine and threonine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolic pathways

Reactome:

Phase I - Functionalization of compounds

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	20523988		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	14755492		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18436961		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26362823	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	20547706		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	32411328	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16487546, 27731409, 28044236, 29653075, 29915377		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16947396, 28067251, 29166944		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	9151788	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16487546, 27731409, 28044236, 29653075, 29915377		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	25457560		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30160019		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	32411328	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21368224	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37856813, 38084139	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28761331, 30304544		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	25457560		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29175057		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20877383, 29175057, 30597511		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28428344	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	CTD_human_DG	23154672		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30413396, 30633060, 31743166		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	CTD_human_DG	23154672		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	25342050		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29229088		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30658395		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26912327		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26912327	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37774061, 38078879	Associate	★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	31819770		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29653075		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	14755492		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12686114, 15541390, 15830186, 16487546, 18413170, 29364582, 30022055		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12686114, 15541390, 15830186, 16487546, 18413170, 28044236, 29364582, 30022055, 31182088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	23154672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	29364582	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	32411328	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15830186		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12686114, 15830186		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	12466139		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	14977883		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28601507, 28988626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28662230		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	30160019		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	30160019		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28437839		★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	36335313	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	29364582	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30658395		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29490166		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	32411328	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	35527426	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	29261141	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28044236		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28044236		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30022055		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29364582	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	15830186, 29364582		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	23154672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28251930		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	14755492		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	18436961, 28662230		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18644360		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	29364582	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28318627, 30633060, 31512003, 31743166		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	10595925	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28428344, 30658395		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28428344	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31819770		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30160019		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29065711		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15057044		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21428797		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29716612, 30134823, 30597511		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30304544		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	10898423	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	14755492		★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOFIBRILLAR, DESMIN-RELATED	Myofibrillar myopathy	BEFREE	14755492		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20523988, 26912327, 27036009, 30160019		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	12686114		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	14977883		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	14977883, 22238597, 28044236		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29261141		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	31146362	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31146362		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36189307	Associate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	CTD_human_DG	22633222		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29259392		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	28428344		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	22618595, 28937866, 29259392		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23716368	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24118377		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34012494	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28251930		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26362823	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39529035	Associate	★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	LHGDN	17431736		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	21819380, 25457560		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	26362823	Associate	★☆☆☆☆ Found in Text Mining only