Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8638
Gene name	2'-5'-oligoadenylate synthetase like
Gene symbol	OASL
Synonyms (NCBI Gene)	OASL1OASLdTRIP-14TRIP14p59 OASLp59-OASLp59OASL
Chromosome	12
Chromosome location	12q24.31

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021250	hsa-miR-146a-5p	Microarray	18057241
MIRT022684	hsa-miR-124-3p	Microarray	18668037
MIRT023766	hsa-miR-1-3p	Microarray	18668037
MIRT1201245	hsa-miR-3934	CLIP-seq
MIRT1201246	hsa-miR-5095	CLIP-seq
MIRT1201247	hsa-miR-552	CLIP-seq
MIRT1201248	hsa-miR-610	CLIP-seq
MIRT2058150	hsa-miR-1224-3p	CLIP-seq
MIRT2058151	hsa-miR-1234	CLIP-seq
MIRT2058152	hsa-miR-1260	CLIP-seq
MIRT2058153	hsa-miR-1260b	CLIP-seq
MIRT2058154	hsa-miR-1280	CLIP-seq
MIRT2058155	hsa-miR-4268	CLIP-seq
MIRT2058156	hsa-miR-518e	CLIP-seq
MIRT2058157	hsa-miR-532-3p	CLIP-seq
MIRT2058150	hsa-miR-1224-3p	CLIP-seq
MIRT2058151	hsa-miR-1234	CLIP-seq
MIRT2584635	hsa-miR-1255a	CLIP-seq
MIRT2584636	hsa-miR-1255b	CLIP-seq
MIRT2058152	hsa-miR-1260	CLIP-seq
MIRT2058153	hsa-miR-1260b	CLIP-seq
MIRT2058154	hsa-miR-1280	CLIP-seq
MIRT2584637	hsa-miR-1299	CLIP-seq
MIRT2584638	hsa-miR-150	CLIP-seq
MIRT2584639	hsa-miR-1912	CLIP-seq
MIRT2584640	hsa-miR-3130-5p	CLIP-seq
MIRT2584641	hsa-miR-3176	CLIP-seq
MIRT2584642	hsa-miR-3192	CLIP-seq
MIRT2584643	hsa-miR-3545-3p	CLIP-seq
MIRT2584644	hsa-miR-3649	CLIP-seq
MIRT2584645	hsa-miR-3661	CLIP-seq
MIRT2584646	hsa-miR-3663-5p	CLIP-seq
MIRT2584647	hsa-miR-3919	CLIP-seq
MIRT2584648	hsa-miR-3922-3p	CLIP-seq
MIRT1201245	hsa-miR-3934	CLIP-seq
MIRT2058155	hsa-miR-4268	CLIP-seq
MIRT2584649	hsa-miR-4289	CLIP-seq
MIRT2584650	hsa-miR-4299	CLIP-seq
MIRT2584651	hsa-miR-4314	CLIP-seq
MIRT2584652	hsa-miR-4482	CLIP-seq
MIRT2584653	hsa-miR-4635	CLIP-seq
MIRT2584654	hsa-miR-4638-5p	CLIP-seq
MIRT2584655	hsa-miR-4646-5p	CLIP-seq
MIRT2584656	hsa-miR-4680-5p	CLIP-seq
MIRT2584657	hsa-miR-4713-5p	CLIP-seq
MIRT2584658	hsa-miR-4782-5p	CLIP-seq
MIRT2584659	hsa-miR-4797-5p	CLIP-seq
MIRT2584660	hsa-miR-4802-3p	CLIP-seq
MIRT1201246	hsa-miR-5095	CLIP-seq
MIRT2584661	hsa-miR-516b	CLIP-seq
MIRT2058156	hsa-miR-518e	CLIP-seq
MIRT2058157	hsa-miR-532-3p	CLIP-seq
MIRT2584662	hsa-miR-548a-3p	CLIP-seq
MIRT2584663	hsa-miR-548e	CLIP-seq
MIRT2584664	hsa-miR-548f	CLIP-seq
MIRT1201247	hsa-miR-552	CLIP-seq
MIRT2584665	hsa-miR-582-3p	CLIP-seq
MIRT1201248	hsa-miR-610	CLIP-seq
MIRT2584666	hsa-miR-631	CLIP-seq
MIRT2584667	hsa-miR-661	CLIP-seq
MIRT2584668	hsa-miR-936	CLIP-seq
MIRT2058150	hsa-miR-1224-3p	CLIP-seq
MIRT2058151	hsa-miR-1234	CLIP-seq
MIRT2584635	hsa-miR-1255a	CLIP-seq
MIRT2584636	hsa-miR-1255b	CLIP-seq
MIRT2058152	hsa-miR-1260	CLIP-seq
MIRT2058153	hsa-miR-1260b	CLIP-seq
MIRT2058154	hsa-miR-1280	CLIP-seq
MIRT2584637	hsa-miR-1299	CLIP-seq
MIRT2584638	hsa-miR-150	CLIP-seq
MIRT2584639	hsa-miR-1912	CLIP-seq
MIRT2584640	hsa-miR-3130-5p	CLIP-seq
MIRT2584641	hsa-miR-3176	CLIP-seq
MIRT2584642	hsa-miR-3192	CLIP-seq
MIRT2584643	hsa-miR-3545-3p	CLIP-seq
MIRT2584644	hsa-miR-3649	CLIP-seq
MIRT2584645	hsa-miR-3661	CLIP-seq
MIRT2584646	hsa-miR-3663-5p	CLIP-seq
MIRT2584647	hsa-miR-3919	CLIP-seq
MIRT2584648	hsa-miR-3922-3p	CLIP-seq
MIRT1201245	hsa-miR-3934	CLIP-seq
MIRT2058155	hsa-miR-4268	CLIP-seq
MIRT2584649	hsa-miR-4289	CLIP-seq
MIRT2584650	hsa-miR-4299	CLIP-seq
MIRT2584651	hsa-miR-4314	CLIP-seq
MIRT2584652	hsa-miR-4482	CLIP-seq
MIRT2584653	hsa-miR-4635	CLIP-seq
MIRT2584654	hsa-miR-4638-5p	CLIP-seq
MIRT2584655	hsa-miR-4646-5p	CLIP-seq
MIRT2584656	hsa-miR-4680-5p	CLIP-seq
MIRT2584657	hsa-miR-4713-5p	CLIP-seq
MIRT2584658	hsa-miR-4782-5p	CLIP-seq
MIRT2584659	hsa-miR-4797-5p	CLIP-seq
MIRT2584660	hsa-miR-4802-3p	CLIP-seq
MIRT1201246	hsa-miR-5095	CLIP-seq
MIRT2584661	hsa-miR-516b	CLIP-seq
MIRT2058156	hsa-miR-518e	CLIP-seq
MIRT2058157	hsa-miR-532-3p	CLIP-seq
MIRT2584662	hsa-miR-548a-3p	CLIP-seq
MIRT2584663	hsa-miR-548e	CLIP-seq
MIRT2584664	hsa-miR-548f	CLIP-seq
MIRT1201247	hsa-miR-552	CLIP-seq
MIRT2584665	hsa-miR-582-3p	CLIP-seq
MIRT1201248	hsa-miR-610	CLIP-seq
MIRT2584666	hsa-miR-631	CLIP-seq
MIRT2584667	hsa-miR-661	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IDA	9826176
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IDA	9826176
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	9826176, 25925578
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	30833792, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	9826176
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	9826176
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0009615	Process	Response to virus	IDA	18931074, 20074559
GO:0009615	Process	Response to virus	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0045071	Process	Negative regulation of viral genome replication	IBA
GO:0045071	Process	Negative regulation of viral genome replication	IDA	18931074, 20074559
GO:0045087	Process	Innate immune response	IEA
GO:0046966	Function	Nuclear thyroid hormone receptor binding	TAS	7776974
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IBA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEP	32270034
GO:0098542	Process	Defense response to other organism	IEA
GO:0140374	Process	Antiviral innate immune response	IBA
GO:1900246	Process	Positive regulation of RIG-I signaling pathway	IDA	25925578

MIM	HGNC	e!Ensembl
603281	8090	ENSG00000135114

Q15646

Protein name

2'-5'-oligoadenylate synthase-like protein (2'-5'-OAS-related protein) (2'-5'-OAS-RP) (59 kDa 2'-5'-oligoadenylate synthase-like protein) (Thyroid receptor-interacting protein 14) (TR-interacting protein 14) (TRIP-14) (p59 OASL) (p59OASL)

Protein function

Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L. {ECO:0000269|PubMe

PDB

1WH3 , 4XQ7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10421	OAS1_C	168 → 351		Domain
PF00240	ubiquitin	436 → 507	Ubiquitin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.

Sequence

MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVR
VLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLD
LGLEDLRMEQRVPDALVFTIQTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKA
CGGPGNFCPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVKARSPRANLPPLYALELLT
IYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKYYTLHNAIIEDCVRKQLKKER
PIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRARDIHLTVEQ
RGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQG
QVLQDWLGLGIYGIQDSDTLILSKKKGEALFPAS

Sequence length

514

Interactions

View interactions

	KEGG		Reactome
	Human papillomavirus infection		Interferon gamma signaling OAS antiviral response Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29973208, 34079550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	38373824	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32560641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	36765396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29508110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32545414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33229623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	29947923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	20581827, 28869590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	20581827, 21647700, 22885922, 23300278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36007277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	16565890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16947629, 32321151, 34079550, 35967341, 36765396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	16565890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16565890, 16947629, 25344775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	16565890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29508110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	23690996, 28569178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36510962, 37174688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29141788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33253099, 35183246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36189916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36510962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24328427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36162993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37174688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	36333342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OASL (2'-5'-oligoadenylate synthetase like)