Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8637
Gene name	Eukaryotic translation initiation factor 4E binding protein 3
Gene symbol	EIF4EBP3
Synonyms (NCBI Gene)	4E-BP34EBP3
Chromosome	5
Chromosome location	5q31.3
Summary	This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap struct

190

Show/Hide all (190)

miRTarBase ID	miRNA	Experiments	Reference
MIRT484105	hsa-miR-4519	PAR-CLIP	20371350
MIRT484106	hsa-miR-5693	PAR-CLIP	20371350
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT484102	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484101	hsa-miR-4510	PAR-CLIP	20371350
MIRT484100	hsa-miR-6127	PAR-CLIP	20371350
MIRT484099	hsa-miR-6129	PAR-CLIP	20371350
MIRT484098	hsa-miR-6130	PAR-CLIP	20371350
MIRT484097	hsa-miR-6133	PAR-CLIP	20371350
MIRT484096	hsa-miR-6134	PAR-CLIP	20371350
MIRT484095	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT484105	hsa-miR-4519	PAR-CLIP	20371350
MIRT484106	hsa-miR-5693	PAR-CLIP	20371350
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT484102	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484101	hsa-miR-4510	PAR-CLIP	20371350
MIRT484100	hsa-miR-6127	PAR-CLIP	20371350
MIRT484099	hsa-miR-6129	PAR-CLIP	20371350
MIRT484098	hsa-miR-6130	PAR-CLIP	20371350
MIRT484097	hsa-miR-6133	PAR-CLIP	20371350
MIRT484096	hsa-miR-6134	PAR-CLIP	20371350
MIRT484095	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT484105	hsa-miR-4519	PAR-CLIP	23592263
MIRT484106	hsa-miR-5693	PAR-CLIP	23592263
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT484102	hsa-miR-4419a	PAR-CLIP	23592263
MIRT484101	hsa-miR-4510	PAR-CLIP	23592263
MIRT484100	hsa-miR-6127	PAR-CLIP	23592263
MIRT484099	hsa-miR-6129	PAR-CLIP	23592263
MIRT484098	hsa-miR-6130	PAR-CLIP	23592263
MIRT484097	hsa-miR-6133	PAR-CLIP	23592263
MIRT484096	hsa-miR-6134	PAR-CLIP	23592263
MIRT484095	hsa-miR-885-3p	PAR-CLIP	23592263
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	23592263
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT484105	hsa-miR-4519	PAR-CLIP	23592263
MIRT484106	hsa-miR-5693	PAR-CLIP	23592263
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT484102	hsa-miR-4419a	PAR-CLIP	23592263
MIRT484101	hsa-miR-4510	PAR-CLIP	23592263
MIRT484100	hsa-miR-6127	PAR-CLIP	23592263
MIRT484099	hsa-miR-6129	PAR-CLIP	23592263
MIRT484098	hsa-miR-6130	PAR-CLIP	23592263
MIRT484097	hsa-miR-6133	PAR-CLIP	23592263
MIRT484096	hsa-miR-6134	PAR-CLIP	23592263
MIRT484095	hsa-miR-885-3p	PAR-CLIP	23592263
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	23592263
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	27292025
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	27292025
MIRT484102	hsa-miR-4419a	PAR-CLIP	27292025
MIRT484101	hsa-miR-4510	PAR-CLIP	27292025
MIRT484105	hsa-miR-4519	PAR-CLIP	27292025
MIRT484106	hsa-miR-5693	PAR-CLIP	27292025
MIRT484100	hsa-miR-6127	PAR-CLIP	27292025
MIRT484099	hsa-miR-6129	PAR-CLIP	27292025
MIRT484098	hsa-miR-6130	PAR-CLIP	27292025
MIRT484097	hsa-miR-6133	PAR-CLIP	27292025
MIRT484096	hsa-miR-6134	PAR-CLIP	27292025
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	27292025
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	27292025
MIRT484095	hsa-miR-885-3p	PAR-CLIP	27292025
MIRT484105	hsa-miR-4519	PAR-CLIP	20371350
MIRT484106	hsa-miR-5693	PAR-CLIP	20371350
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT484102	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484101	hsa-miR-4510	PAR-CLIP	20371350
MIRT484100	hsa-miR-6127	PAR-CLIP	20371350
MIRT484099	hsa-miR-6129	PAR-CLIP	20371350
MIRT484098	hsa-miR-6130	PAR-CLIP	20371350
MIRT484097	hsa-miR-6133	PAR-CLIP	20371350
MIRT484096	hsa-miR-6134	PAR-CLIP	20371350
MIRT484095	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT484105	hsa-miR-4519	PAR-CLIP	20371350
MIRT484106	hsa-miR-5693	PAR-CLIP	20371350
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT484102	hsa-miR-4419a	PAR-CLIP	20371350
MIRT484101	hsa-miR-4510	PAR-CLIP	20371350
MIRT484100	hsa-miR-6127	PAR-CLIP	20371350
MIRT484099	hsa-miR-6129	PAR-CLIP	20371350
MIRT484098	hsa-miR-6130	PAR-CLIP	20371350
MIRT484097	hsa-miR-6133	PAR-CLIP	20371350
MIRT484096	hsa-miR-6134	PAR-CLIP	20371350
MIRT484095	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	20371350
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT484105	hsa-miR-4519	PAR-CLIP	23592263
MIRT484106	hsa-miR-5693	PAR-CLIP	23592263
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT484102	hsa-miR-4419a	PAR-CLIP	23592263
MIRT484101	hsa-miR-4510	PAR-CLIP	23592263
MIRT484100	hsa-miR-6127	PAR-CLIP	23592263
MIRT484099	hsa-miR-6129	PAR-CLIP	23592263
MIRT484098	hsa-miR-6130	PAR-CLIP	23592263
MIRT484097	hsa-miR-6133	PAR-CLIP	23592263
MIRT484096	hsa-miR-6134	PAR-CLIP	23592263
MIRT484095	hsa-miR-885-3p	PAR-CLIP	23592263
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	23592263
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT484105	hsa-miR-4519	PAR-CLIP	23592263
MIRT484106	hsa-miR-5693	PAR-CLIP	23592263
MIRT484104	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT484103	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT484102	hsa-miR-4419a	PAR-CLIP	23592263
MIRT484101	hsa-miR-4510	PAR-CLIP	23592263
MIRT484100	hsa-miR-6127	PAR-CLIP	23592263
MIRT484099	hsa-miR-6129	PAR-CLIP	23592263
MIRT484098	hsa-miR-6130	PAR-CLIP	23592263
MIRT484097	hsa-miR-6133	PAR-CLIP	23592263
MIRT484096	hsa-miR-6134	PAR-CLIP	23592263
MIRT484095	hsa-miR-885-3p	PAR-CLIP	23592263
MIRT484094	hsa-miR-3622b-5p	PAR-CLIP	23592263
MIRT484093	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT484092	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT958715	hsa-miR-3189-5p	CLIP-seq
MIRT958716	hsa-miR-4758-3p	CLIP-seq
MIRT2219228	hsa-miR-4695-5p	CLIP-seq
MIRT2219229	hsa-miR-4755-3p	CLIP-seq
MIRT2219230	hsa-miR-4764-3p	CLIP-seq
MIRT2522439	hsa-miR-1258	CLIP-seq
MIRT2522440	hsa-miR-125a-5p	CLIP-seq
MIRT2522441	hsa-miR-125b	CLIP-seq
MIRT2522442	hsa-miR-136	CLIP-seq
MIRT2522443	hsa-miR-140-3p	CLIP-seq
MIRT2522444	hsa-miR-182	CLIP-seq
MIRT2522445	hsa-miR-1911	CLIP-seq
MIRT2522446	hsa-miR-2355-5p	CLIP-seq
MIRT2522447	hsa-miR-2909	CLIP-seq
MIRT2522448	hsa-miR-296-3p	CLIP-seq
MIRT2522449	hsa-miR-31	CLIP-seq
MIRT2522450	hsa-miR-3125	CLIP-seq
MIRT2522451	hsa-miR-3145-5p	CLIP-seq
MIRT2522452	hsa-miR-3158-3p	CLIP-seq
MIRT2522453	hsa-miR-3916	CLIP-seq
MIRT2522454	hsa-miR-4266	CLIP-seq
MIRT2522455	hsa-miR-4319	CLIP-seq
MIRT2522456	hsa-miR-4424	CLIP-seq
MIRT2522457	hsa-miR-4494	CLIP-seq
MIRT2522458	hsa-miR-4499	CLIP-seq
MIRT2219228	hsa-miR-4695-5p	CLIP-seq
MIRT2522459	hsa-miR-4709-3p	CLIP-seq
MIRT2522460	hsa-miR-4779	CLIP-seq
MIRT2522461	hsa-miR-508-5p	CLIP-seq
MIRT2522462	hsa-miR-629	CLIP-seq
MIRT2522463	hsa-miR-765	CLIP-seq
MIRT2522439	hsa-miR-1258	CLIP-seq
MIRT2522440	hsa-miR-125a-5p	CLIP-seq
MIRT2522441	hsa-miR-125b	CLIP-seq
MIRT2522442	hsa-miR-136	CLIP-seq
MIRT2522443	hsa-miR-140-3p	CLIP-seq
MIRT2522445	hsa-miR-1911	CLIP-seq
MIRT2522446	hsa-miR-2355-5p	CLIP-seq
MIRT2522447	hsa-miR-2909	CLIP-seq
MIRT2522448	hsa-miR-296-3p	CLIP-seq
MIRT2522450	hsa-miR-3125	CLIP-seq
MIRT2522451	hsa-miR-3145-5p	CLIP-seq
MIRT2522452	hsa-miR-3158-3p	CLIP-seq
MIRT2522453	hsa-miR-3916	CLIP-seq
MIRT2522454	hsa-miR-4266	CLIP-seq
MIRT2522455	hsa-miR-4319	CLIP-seq
MIRT2522456	hsa-miR-4424	CLIP-seq
MIRT2522457	hsa-miR-4494	CLIP-seq
MIRT2522458	hsa-miR-4499	CLIP-seq
MIRT2219228	hsa-miR-4695-5p	CLIP-seq
MIRT2522459	hsa-miR-4709-3p	CLIP-seq
MIRT2522460	hsa-miR-4779	CLIP-seq
MIRT2522461	hsa-miR-508-5p	CLIP-seq
MIRT2522462	hsa-miR-629	CLIP-seq
MIRT2522463	hsa-miR-765	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15153109, 16271312, 22684010, 24722188, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IBA
GO:0008190	Function	Eukaryotic initiation factor 4E binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	NAS	9593750
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030371	Function	Translation repressor activity	IBA
GO:0030371	Function	Translation repressor activity	NAS	9593750
GO:0045947	Process	Negative regulation of translational initiation	IBA
GO:0045947	Process	Negative regulation of translational initiation	IEA
GO:0045947	Process	Negative regulation of translational initiation	NAS	9593750

MIM	HGNC	e!Ensembl
603483	3290	ENSG00000243056

O60516

Protein name

Eukaryotic translation initiation factor 4E-binding protein 3 (4E-BP3) (eIF4E-binding protein 3)

Protein function

Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: the hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repression of translation. In co

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05456	eIF_4EBP	4 → 100	Eukaryotic translation initiation factor 4E binding protein (EIF4EBP)	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is highest in skeletal muscle, heart, kidney, and pancreas, whereas there is very little expression in brain and thymus. {ECO:0000269|PubMed:9593750}.

Sequence

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCC
LPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Sequence length

100

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
cervical cancer	Cervical Cancer	BEFREE	29333098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29333098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21088106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21365634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27319316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29333098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	22297294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	39324142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22161024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	22297294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22161024	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29333098	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF4EBP3 (eukaryotic translation initiation factor 4E binding protein 3)