Gene Gene information from NCBI Gene database.
Entrez ID 8636
Gene name SS nuclear autoantigen 1
Gene symbol SSNA1
Synonyms (NCBI Gene)
N14NA-14NA14
Chromosome 9
Chromosome location 9q34.3
miRNA miRNA information provided by mirtarbase database.
143
miRTarBase ID miRNA Experiments Reference
MIRT001330 hsa-miR-1-3p pSILAC 18668040
MIRT022545 hsa-miR-124-3p Microarray 18668037
MIRT001330 hsa-miR-1-3p Proteomics;Other 18668040
MIRT041367 hsa-miR-193b-3p CLASH 23622248
MIRT2117530 hsa-miR-22 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IDA 34970964
GO:0000226 Process Microtubule cytoskeleton organization ISS
GO:0005515 Function Protein binding IPI 25390646, 25416956, 27173435, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus TAS 9430706
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610882 11321 ENSG00000176101
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43805
Protein name Microtubule nucleation factor SSNA1 (Nuclear autoantigen of 14 kDa) (Sjoegren syndrome nuclear autoantigen 1)
Protein function Microtubule-binding protein which stabilizes dynamic microtubules by slowing growth and shrinkage at both plus and minus ends and serves as a sensor of microtubule damage, protecting microtubules from the microtubule-severing enzyme SPAST (PubMe
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9430706}.
Sequence
MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNEN
LARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS
Sequence length 119
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Chromosome 11p11.2 Deletion Syndrome 11p11.2 Deletion Syndrome BEFREE 22363749
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
PEELING SKIN SYNDROME Peeling Skin Syndrome BEFREE 22363749
★☆☆☆☆
Found in Text Mining only
Sjogren's Syndrome Sjogren syndrome Pubtator 19273306 Associate
★☆☆☆☆
Found in Text Mining only
Systemic Scleroderma Scleroderma BEFREE 22363749
★☆☆☆☆
Found in Text Mining only