Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8624
Gene name	Proteasome assembly chaperone 1
Gene symbol	PSMG1
Synonyms (NCBI Gene)	C21LRPDSCR2LRPC21PAC-1PAC1Pba1
Chromosome	21
Chromosome location	21q22.2

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005249	hsa-miR-155-5p	pSILAC	18668040
MIRT005284	hsa-miR-1-3p	pSILAC	18668040
MIRT005249	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT005284	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT041809	hsa-miR-484	CLASH	23622248
MIRT036600	hsa-miR-940	CLASH	23622248
MIRT654666	hsa-miR-2278	HITS-CLIP	23824327
MIRT654665	hsa-miR-646	HITS-CLIP	23824327
MIRT654664	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT654663	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT654662	hsa-miR-4286	HITS-CLIP	23824327
MIRT654661	hsa-miR-4660	HITS-CLIP	23824327
MIRT654667	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT654666	hsa-miR-2278	HITS-CLIP	23824327
MIRT654665	hsa-miR-646	HITS-CLIP	23824327
MIRT654664	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT654663	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT654662	hsa-miR-4286	HITS-CLIP	23824327
MIRT654661	hsa-miR-4660	HITS-CLIP	23824327
MIRT551269	hsa-miR-890	PAR-CLIP	21572407
MIRT551268	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT551267	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT551265	hsa-miR-5690	PAR-CLIP	21572407
MIRT551266	hsa-miR-6804-3p	PAR-CLIP	21572407
MIRT551264	hsa-miR-3622b-5p	PAR-CLIP	21572407
MIRT551263	hsa-miR-4281	PAR-CLIP	21572407
MIRT551262	hsa-miR-7977	PAR-CLIP	21572407
MIRT551261	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT551260	hsa-miR-133a-3p	PAR-CLIP	21572407
MIRT529873	hsa-miR-5692a	PAR-CLIP	21572407
MIRT529872	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT544719	hsa-miR-577	PAR-CLIP	21572407
MIRT529871	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT529870	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT529869	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT529868	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT529873	hsa-miR-5692a	PAR-CLIP	22012620
MIRT529872	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT529871	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT529870	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT529869	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT529868	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT449997	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT449996	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT449995	hsa-miR-6087	PAR-CLIP	22100165
MIRT449993	hsa-miR-5093	PAR-CLIP	22100165
MIRT449994	hsa-miR-1908-5p	PAR-CLIP	22100165
MIRT449992	hsa-miR-663a	PAR-CLIP	22100165
MIRT449991	hsa-miR-6787-5p	PAR-CLIP	22100165
MIRT449990	hsa-miR-625-5p	PAR-CLIP	22100165
MIRT449989	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT449988	hsa-miR-1273e	PAR-CLIP	22100165
MIRT654666	hsa-miR-2278	HITS-CLIP	23824327
MIRT654665	hsa-miR-646	HITS-CLIP	23824327
MIRT654664	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT654663	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT654662	hsa-miR-4286	HITS-CLIP	23824327
MIRT654661	hsa-miR-4660	HITS-CLIP	23824327
MIRT654667	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT654666	hsa-miR-2278	HITS-CLIP	23824327
MIRT654665	hsa-miR-646	HITS-CLIP	23824327
MIRT654664	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT654663	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT654662	hsa-miR-4286	HITS-CLIP	23824327
MIRT654661	hsa-miR-4660	HITS-CLIP	23824327
MIRT551269	hsa-miR-890	PAR-CLIP	21572407
MIRT551268	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT551267	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT551265	hsa-miR-5690	PAR-CLIP	21572407
MIRT551266	hsa-miR-6804-3p	PAR-CLIP	21572407
MIRT551264	hsa-miR-3622b-5p	PAR-CLIP	21572407
MIRT551263	hsa-miR-4281	PAR-CLIP	21572407
MIRT551262	hsa-miR-7977	PAR-CLIP	21572407
MIRT551261	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT551260	hsa-miR-133a-3p	PAR-CLIP	21572407
MIRT529873	hsa-miR-5692a	PAR-CLIP	21572407
MIRT529872	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT544719	hsa-miR-577	PAR-CLIP	21572407
MIRT529871	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT529870	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT529869	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT529868	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT529873	hsa-miR-5692a	PAR-CLIP	22012620
MIRT529872	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT529871	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT529870	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT529869	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT529868	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT449997	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT449996	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT449995	hsa-miR-6087	PAR-CLIP	22100165
MIRT449993	hsa-miR-5093	PAR-CLIP	22100165
MIRT449994	hsa-miR-1908-5p	PAR-CLIP	22100165
MIRT449992	hsa-miR-663a	PAR-CLIP	22100165
MIRT449991	hsa-miR-6787-5p	PAR-CLIP	22100165
MIRT449990	hsa-miR-625-5p	PAR-CLIP	22100165
MIRT449989	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT449988	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1271026	hsa-miR-361-3p	CLIP-seq
MIRT1271027	hsa-miR-371-5p	CLIP-seq
MIRT1271028	hsa-miR-4698	CLIP-seq
MIRT1271029	hsa-miR-513c	CLIP-seq
MIRT1271030	hsa-miR-514b-5p	CLIP-seq
MIRT2306045	hsa-miR-1283	CLIP-seq
MIRT2306046	hsa-miR-3127-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16251969, 32296183, 33961781, 35271311, 35914814
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15670775
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	15590417
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0021930	Process	Cerebellar granule cell precursor proliferation	IEA
GO:0043248	Process	Proteasome assembly	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	16251969
GO:0051131	Process	Chaperone-mediated protein complex assembly	IGI	17189198
GO:0060090	Function	Molecular adaptor activity	IDA	16251969
GO:0060090	Function	Molecular adaptor activity	IGI	17189198
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IEA
GO:0080129	Process	Proteasome core complex assembly	IBA
GO:0080129	Process	Proteasome core complex assembly	IEA
GO:0101031	Component	Protein folding chaperone complex	IDA	16251969

MIM	HGNC	e!Ensembl
605296	3043	ENSG00000183527

O95456

Protein name

Proteasome assembly chaperone 1 (PAC-1) (Chromosome 21 leucine-rich protein) (C21-LRP) (Down syndrome critical region protein 2) (Proteasome chaperone homolog 1) (Pba1)

Protein function

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the hetero

PDB

8QYJ , 8QYL , 8QYM , 8QYN , 8QYS , 8QZ9 , 8TM3 , 8TM4 , 8TM5 , 8TM6 , 8YIX , 8YIY , 8YIZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16094	PAC1	2 → 287	Proteasome assembly chaperone 4	Family

Tissue specificity

TISSUE SPECIFICITY: In the adult, detected in brain, colon, leukocytes, breast and testis. Widely expressed in the fetus. Also expressed in a variety of proliferating cell lines. {ECO:0000269|PubMed:10872820, ECO:0000269|PubMed:9784380}.

Sequence

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEV
SLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAF
CVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSES
TGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVM
KLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

Sequence length

288

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (78)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	10339498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	8637912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24643394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23972788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23972788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30571484		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26658105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16888207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19958095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10867818, 30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	31326577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11193832, 12409225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	30763823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23628440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25538042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	31792942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18758464, 21818367, 21830272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21830272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33827593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	16823482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28392470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21079743, 21830272, 34561436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21830272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29457374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	28019128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27900577, 29113289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27900577, 29113289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10867818, 29113289, 30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28392470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	16823490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19581838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	19581838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18758464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	14680939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11193832, 12409225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16372333, 16888207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16019382, 27297867, 27566169, 31554935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16019382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	26658105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	24220567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31284862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20974589, 22766684, 28776455, 29500688, 30799680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24030118, 26257207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34561436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10872820, 27151235, 29269017, 31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16226889, 17995938, 19269029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	24220567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	16888199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26261507		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30022438		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	10867818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19006382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27566169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29704474		★★★★★ ★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21350482, 25680674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16372333, 16888207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32338277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10583729, 11166332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30524940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17387318, 19958095, 27383213, 28125634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	20062062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	20228799		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	21818367		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	10867818		★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMG1 (proteasome assembly chaperone 1)